--- lineage_type: import upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/9c9bd2e9/skills/rowan/SKILL.md upstream_sha: 9c9bd2e9 imported_at: 2026-06-27 prompt_class: prompt upstream_changes: accepted name: rowan description: Rowan is a cloud-native molecular modeling and medicinal-chemistry workflow platform with a Python API. Use for pKa and macropKa prediction, conformer and tautomer ensembles, docking and analogue docking, protein-ligand cofolding, MSA generation, molecular dynamics, permeability, descriptor workflows, and related small-molecule or protein modeling tasks. Ideal for programmatic batch screening, multi-step chemistry pipelines, and workflows that would otherwise require maintaining local HPC/GPU infrastructure. license: Proprietary (API key required) compatibility: Python 3.12+, API key required required_environment_variables: [{"name": "ROWAN_API_KEY", "prompt": "Rowan computational chemistry API key.", "required_for": "full functionality"}] metadata: {"version": "1.2", "skill-author": "Rowan Science", "trigger-keywords": "pKa prediction, molecular docking, conformer search, chemistry workflow, drug discovery, SMILES, protein structure, batch molecular modeling, cloud chemistry", "openclaw": {"primaryEnv": "ROWAN_API_KEY", "envVars": [{"name": "ROWAN_API_KEY", "required": true, "description": "Rowan computational chemistry API key."}]}} --- # Rowan: Cloud-Native Molecular-Modeling and Drug-Design Workflows ## Overview Rowan is a cloud-native workflow platform for molecular simulation, medicinal chemistry, and structure-based design. Its Python API exposes a unified interface for small-molecule modeling, property prediction, docking, molecular dynamics, and AI structure workflows. Use Rowan when you want to run medicinal-chemistry or molecular-design workflows programmatically without maintaining local HPC infrastructure, GPU provisioning, or a collection of separate modeling tools. Rowan handles all infrastructure, result management, and computation scaling. ## When to use Rowan **Rowan is a good fit for:** - Quantum chemistry, semiempirical methods, or neural network potentials - Batch property prediction (pKa, descriptors, permeability, solubility) - Conformer and tautomer ensemble generation - Docking workflows (single-ligand, analogue series, pose refinement) - Protein-ligand cofolding and MSA generation - Multi-step chemistry pipelines (e.g., tautomer search → docking → pose analysis) - Batch medicinal-chemistry campaigns where you need consistent, scalable infrastructure **Rowan is not the right fit for:** - Simple molecular I/O (use RDKit directly) - Post-HF *ab initio* quantum chemistry or relativistic calculations ## Access and pricing model Rowan uses a credit-based usage model. All users, including free-tier users, can create API keys and use the Python API. ### Free-tier access - Access to all Rowan core workflows - 20 credits per week - 500 signup credits ### Pricing and credit consumption Credits are consumed according to compute type: - **CPU**: 1 credit per minute - **GPU**: 3 credits per minute - **H100/H200 GPU**: 7 credits per minute Purchased credits are priced per credit and remain valid for up to one year from purchase. ### Typical cost estimates | Workflow | Typical Runtime | Estimated Credits | Notes | |----------|----------------|-------------------|-------| | Descriptors | <1 min | 0.5–2 | Lightweight, good for triage | | pKa (single transition) | 2–5 min | 2–5 | Depends on molecule size | | MacropKa (pH 0–14) | 5–15 min | 5–15 | Broader sampling, higher cost | | Conformer search | 3–10 min | 3–10 | Ensemble quality matters | | Tautomer search | 2–5 min | 2–5 | Heterocyclic systems | | Docking (single ligand) | 5–20 min | 5–20 | Depends on pocket size, refinement | | Analogue docking series (10–50 ligands) | 30–120 min | 30–100+ | Shared reference frame | | MSA generation | 5–30 min | 5–30 | Sequence length dependent | | Protein-ligand cofolding | 15–60 min | 20–50+ | AI structure prediction, GPU-heavy | ## Quick start ```bash uv pip install rowan-python ``` ```python import rowan rowan.api_key = "your_api_key_here" # or set ROWAN_API_KEY env var # Submit a descriptors workflow — completes in under a minute wf = rowan.submit_descriptors_workflow("CC(=O)Oc1ccccc1C(=O)O", name="aspirin") result = wf.result() print(result.descriptors['MW']) # 180.16 print(result.descriptors['SLogP']) # 1.19 print(result.descriptors['TPSA']) # 59.44 ``` If that prints without error, you're set up correctly. ## Installation ```bash uv pip install rowan-python # or: pip install rowan-python ``` ## User and webhook management ### Authentication Set an API key via environment variable (recommended): ```bash export ROWAN_API_KEY="your_api_key_here" ``` Or set directly in Python: ```python import rowan rowan.api_key = "your_api_key_here" ``` Verify authentication: ```python import rowan user = rowan.whoami() # Returns user info if authenticated print(f"User: {user.email}") print(f"Credits available: {user.credits_available_string}") ``` ### Webhook secret management For webhook signature verification, manage secrets through your user account: ```python import rowan # Get your current webhook secret (returns None if none exists) secret = rowan.get_webhook_secret() if secret is None: secret = rowan.create_webhook_secret() print(f"Secret key: {secret.secret}") # Rotate your secret (invalidates old, creates new) # Use this periodically for security new_secret = rowan.rotate_webhook_secret() print(f"New secret created (old secret disabled): {new_secret.secret}") # Verify incoming webhook signatures is_valid = rowan.verify_webhook_secret( request_body=b"...", # Raw request body (bytes) signature="X-Rowan-Signature", # From request header secret=secret.secret ) ``` ## Molecule input formats Rowan accepts molecules in the following formats: - **SMILES** (preferred): `"CCO"`, `"c1ccccc1O"` - **SMARTS patterns** (for some workflows): subset of SMARTS for substructure matching - **InChI** (if supported in your API version): `"InChI=1S/C2H6O/c1-2-3/h3H,2H2,1H3"` The API will validate input and raise a `rowan.ValidationError` if a molecule cannot be parsed. Always use canonicalized SMILES for reproducibility. **Tip:** Use RDKit to validate SMILES before submission: ```python from rdkit import Chem smiles = "CCO" mol = Chem.MolFromSmiles(smiles) if mol is None: raise ValueError(f"Invalid SMILES: {smiles}") ``` ## Core usage pattern Most Rowan tasks follow the same three-step pattern: 1. **Submit** a workflow 2. **Wait** for completion (with optional streaming) 3. **Retrieve** typed results with convenience properties ```python import rowan # 1. Submit — use the specific workflow function (not the generic submit_workflow) workflow = rowan.submit_descriptors_workflow( "CC(=O)Oc1ccccc1C(=O)O", name="aspirin descriptors", ) # 2. & 3. Wait and retrieve result = workflow.result() # Blocks until done (default: wait=True, poll_interval=5) print(result.data) # Raw dict print(result.descriptors['MW']) # 180.16 — use result.descriptors dict, not result.molecular_weight ``` For long-running workflows, use streaming: ```python for partial in workflow.stream_result(poll_interval=5): print(f"Progress: {partial.complete}%") print(partial.data) ``` ### result() vs. stream_result() | Pattern | Use When | Duration | |---------|----------|----------| | `result()` | You can wait for the full result | <5 min typical | | `stream_result()` | You want progress feedback or need early partial results | >5 min, or interactive use | **Guideline:** Use `result()` for descriptors, pKa. Use `stream_result()` for conformer search, docking, cofolding. ## Working with results Rowan's API includes **typed workflow result objects** with convenience properties. ### Using typed properties and .data Results have two access patterns: 1. **Convenience properties** (recommended first): `result.descriptors`, `result.best_pose`, `result.conformer_energies` 2. **Raw fallback**: `result.data` — raw dictionary from the API Example: ```python result = rowan.submit_descriptors_workflow( "CCO", name="ethanol", ).result() # Convenience property (returns dict of all descriptors): print(result.descriptors['MW']) # 46.042 print(result.descriptors['SLogP']) # -0.001 print(result.descriptors['TPSA']) # 57.96 # Raw data fallback (descriptors are nested under 'descriptors' key): print(result.data['descriptors']) # {'MW': 46.042, 'SLogP': -0.001, 'TPSA': 57.96, 'nHBDon': 1.0, 'nHBAcc': 1.0, ...} ``` **Note:** `DescriptorsResult` does **not** have a `molecular_weight` property. Descriptor keys use short names (`MW`, `SLogP`, `nHBDon`) not verbose names. ### Cache invalidation Some result properties are lazily loaded (e.g., conformer geometries, protein structures). To refresh: ```python result.clear_cache() new_structures = result.conformer_molecules # Refetched ``` ## Projects, folders, and organization For nontrivial campaigns, use projects and folders to keep work organized. ### Projects ```python import rowan # Create a project project = rowan.create_project(name="CDK2 lead optimization") rowan.set_project("CDK2 lead optimization") # All subsequent workflows go into this project wf = rowan.submit_descriptors_workflow("CCO", name="test compound") # Retrieve later project = rowan.retrieve_project("CDK2 lead optimization") workflows = rowan.list_workflows(project=project, size=50) ``` ### Folders ```python # Create a hierarchical folder structure folder = rowan.create_folder(name="docking/batch_1/screening") wf = rowan.submit_docking_workflow( # ... docking params ... folder=folder, name="compound_001", ) # List workflows in a folder results = rowan.list_workflows(folder=folder) ``` ## Workflow decision trees ### pKa vs. MacropKa **Use microscopic pKa when:** - You need the pKa of a single ionizable group - You're interested in acid–base transitions and protonation thermodynamics - The molecule has one or two ionizable sites - Speed is critical (faster, fewer credits) **Use macropKa when:** - You need pH-dependent behavior across a physiologically relevant range (e.g., 0–14) - You want aggregated charge and protonation-state populations across pH - The molecule has multiple ionizable groups with coupled protonation - You need downstream properties like aqueous solubility at different pH **Example decision:** ```text Phenol (pKa ~10): Use microscopic pKa Amine (pKa ~9–10): Use microscopic pKa Multi-ionizable drug (N, O, acidic group): Use macropKa ADME assessment across GI pH: Use macropKa ``` ### Conformer search vs. tautomer search **Use conformer search when:** - A single tautomeric form is known - You need a diverse 3D ensemble for docking, MD, or SAR analysis - Rotatable bonds dominate the chemical space **Use tautomer search when:** - Tautomeric equilibrium is uncertain (e.g., heterocycles, keto–enol systems) - You need to model all relevant protonation isomers - Downstream calculations (docking, pKa) depend on tautomeric form **Combined workflow:** ```python # Step 1: Find best tautomer taut_wf = rowan.submit_tautomer_search_workflow( initial_molecule="O=c1[nH]ccnc1", name="imidazole tautomers", ) best_taut = taut_wf.result().best_tautomer # Step 2: Generate conformers from best tautomer conf_wf = rowan.submit_conformer_search_workflow( initial_molecule=best_taut, name="imidazole conformers", ) ``` ### Docking vs. analogue docking vs. cofolding | Workflow | Use When | Input | Output | |----------|----------|-------|--------| | Docking | Single ligand, known pocket | Protein + SMILES + pocket coords | Pose, score, dG | | Analogue docking | 5–100+ related compounds | Protein + SMILES list + reference ligand | All poses, reference-aligned | | Protein-ligand cofolding | Sequence + ligand, no crystal structure | Protein sequence + SMILES | ML-predicted bound complex | ## Common workflow categories ### 1. Descriptors A lightweight entry point for batch triage, SAR, or exploratory scripts. ```python wf = rowan.submit_descriptors_workflow( "CC(=O)Oc1ccccc1C(=O)O", # positional arg, accepts SMILES string name="aspirin descriptors", ) result = wf.result() print(result.descriptors['MW']) # 180.16 print(result.descriptors['SLogP']) # 1.19 print(result.descriptors['TPSA']) # 59.44 print(result.data['descriptors']) # {'MW': 180.16, 'SLogP': 1.19, 'TPSA': 59.44, 'nHBDon': 1.0, 'nHBAcc': 4.0, ...} ``` **Common descriptor keys:** | Key | Description | Typical drug range | |-----|-------------|-------------------| | `MW` | Molecular weight (Da) | <500 (Lipinski) | | `SLogP` | Calculated LogP (lipophilicity) | -2 to +5 | | `TPSA` | Topological polar surface area (Ų) | <140 for oral bioavailability | | `nHBDon` | H-bond donor count | ≤5 (Lipinski) | | `nHBAcc` | H-bond acceptor count | ≤10 (Lipinski) | | `nRot` | Rotatable bond count | <10 for oral drugs | | `nRing` | Ring count | — | | `nHeavyAtom` | Heavy atom count | — | | `FilterItLogS` | Estimated aqueous solubility (LogS) | >-4 preferred | | `Lipinski` | Lipinski Ro5 pass (1.0) or fail (0.0) | — | The result contains hundreds of additional molecular descriptors (BCUT, GETAWAY, WHIM, etc.); access any via `result.descriptors['key']`. ### 2. Microscopic pKa For protonation-state energetics and acid/base behavior of a specific structure. Two methods are available: | Method | Input | Speed | Covers | Use when | |--------|-------|-------|--------|----------| | `chemprop_nevolianis2025` | SMILES string | Fast | Deprotonation only (anionic conjugate bases) | Acidic groups only; quick screening | | `starling` | SMILES string | Fast | Acid + base (full protonation/deprotonation) | Most drug-like molecules; preferred SMILES method | | `aimnet2_wagen2024` (default) | 3D molecule object | Slower, higher accuracy | Acid + base | You already have a 3D structure (e.g. from conformer search) | ```python # Fast path: SMILES input with full acid+base coverage (use starling method when available) wf = rowan.submit_pka_workflow( initial_molecule="c1ccccc1O", # phenol SMILES; param is initial_molecule, not initial_smiles method="starling", # fast SMILES method, covers acid+base; chemprop_nevolianis2025 is deprotonation-only name="phenol pKa", ) result = wf.result() print(result.strongest_acid) # 9.81 (pKa of the most acidic site) print(result.conjugate_bases) # list of {pka, smiles, atom_index, ...} per deprotonatable site ``` ### 3. MacropKa For pH-dependent protonation behavior across a range. ```python wf = rowan.submit_macropka_workflow( initial_smiles="CN1CCN(CC1)C2=NC=NC3=CC=CC=C32", # imidazole min_pH=0, max_pH=14, min_charge=-2, # default max_charge=2, # default compute_aqueous_solubility=True, # default name="imidazole macropKa", ) result = wf.result() print(result.pka_values) # list of pKa values print(result.logd_by_ph) # dict of {pH: logD} print(result.aqueous_solubility_by_ph) # dict of {pH: solubility} print(result.isoelectric_point) # isoelectric point print(result.data) # {'pKa_values': [...], 'logD_by_pH': {...}, 'aqueous_solubility_by_pH': {...}, ...} ``` ### 4. Conformer search For 3D ensemble generation when ensemble quality matters. ```python wf = rowan.submit_conformer_search_workflow( initial_molecule="CCOC(=O)N1CCC(CC1)Oc1ncnc2ccccc12", num_conformers=50, # Optional: override default name="conformer search", ) result = wf.result() print(result.conformer_energies) # [0.0, 1.2, 2.5, ...] print(result.conformer_molecules) # List of 3D molecules print(result.best_conformer) # Lowest-energy conformer ``` ### 5. Tautomer search For heterocycles and systems where tautomer state affects downstream modeling. ```python wf = rowan.submit_tautomer_search_workflow( initial_molecule="O=c1[nH]ccnc1", # or keto tautomer name="imidazolone tautomers", ) result = wf.result() print(result.best_tautomer) # Most stable SMILES string print(result.tautomers) # List of tautomeric SMILES print(result.molecules) # List of molecule objects ``` ### 6. Docking For protein-ligand docking with optional pose refinement and conformer generation. ```python # Upload protein once, reuse in multiple workflows protein = rowan.upload_protein( name="CDK2", file_path="cdk2.pdb", ) # Define binding pocket pocket = { "center": [10.5, 24.2, 31.8], "size": [18.0, 18.0, 18.0], } # Submit docking wf = rowan.submit_docking_workflow( protein=protein, pocket=pocket, initial_molecule="CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", do_pose_refinement=True, do_conformer_search=True, name="lead docking", ) result = wf.result() print(result.scores) # Docking scores (kcal/mol) print(result.best_pose) # Mol object with 3D coordinates print(result.data) # Raw result dict ``` **Protein preparation tips:** - PDB files should be reasonably clean (remove water/heteroatoms unless intended) - Use the same protein object across a docking series for consistency - If you have a PDB ID, use `rowan.create_protein_from_pdb_id()` instead ### 7. Analogue docking For placing a compound series into a shared binding context. ```python # Analogue series (e.g., SAR campaign) analogues = [ "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", # reference "CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1", # chloro "CCNc1ncc(c(Nc2ccc(OC)cc2)n1)-c1cccnc1", # methoxy "CCNc1ncc(c(Nc2cc(C)c(F)cc2)n1)-c1cccnc1", # methyl, fluoro ] wf = rowan.submit_analogue_docking_workflow( analogues=analogues, initial_molecule=analogues[0], # Reference ligand protein=protein, pocket=pocket, name="SAR series docking", ) result = wf.result() print(result.analogue_scores) # List of scores for each analogue print(result.best_poses) # List of poses ``` ### 8. MSA generation For multiple-sequence alignment (useful for downstream cofolding). ```python wf = rowan.submit_msa_workflow( initial_protein_sequences=[ "MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP" ], output_formats=["colabfold", "chai", "boltz"], name="target MSA", ) result = wf.result() result.download_files() # Downloads alignments to disk ``` ### 9. Protein-ligand cofolding For AI-based bound-complex prediction when no crystal structure is available. ```python wf = rowan.submit_protein_cofolding_workflow( initial_protein_sequences=[ "MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP" ], initial_smiles_list=[ "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1" ], name="protein-ligand cofolding", ) result = wf.result() print(result.predictions) # List of predicted structures print(result.messages) # Model metadata/warnings predicted_structure = result.get_predicted_structure() predicted_structure.write("predicted_complex.pdb") ``` ## All supported workflow types All workflows follow the same submit → wait → retrieve pattern and support webhooks and project/folder organization. ### Core molecular modeling workflows | Workflow | Function | When to use | |----------|----------|-------------| | Descriptors | `submit_descriptors_workflow` | First-pass triage: MW, LogP, TPSA, HBA/HBD, Lipinski filter | | pKa | `submit_pka_workflow` | Single ionizable group; need protonation thermodynamics | | MacropKa | `submit_macropka_workflow` | Multi-ionizable drugs; pH-dependent charge/LogD/solubility | | Conformer Search | `submit_conformer_search_workflow` | 3D ensemble for docking, MD, or SAR; known tautomer | | Tautomer Search | `submit_tautomer_search_workflow` | Heterocycles, keto–enol; uncertain tautomeric form | | Solubility | `submit_solubility_workflow` | Aqueous or solvent-specific solubility prediction | | Membrane Permeability | `submit_membrane_permeability_workflow` | Caco-2, PAMPA, BBB, plasma permeability | | ADMET | `submit_admet_workflow` | Broad drug-likeness and ADMET property sweep | ### Structure-based design workflows | Workflow | Function | When to use | |----------|----------|-------------| | Docking | `submit_docking_workflow` | Single ligand, known binding pocket | | Analogue Docking | `submit_analogue_docking_workflow` | SAR series (5–100+ compounds) in a shared pocket | | Batch Docking | `submit_batch_docking_workflow` | Fast library screening; large compound sets | | Protein MD | `submit_protein_md_workflow` | Long-timescale dynamics; conformational sampling | | Pose Analysis MD | `submit_pose_analysis_md_workflow` | MD refinement of a docking pose | | Protein Cofolding | `submit_protein_cofolding_workflow` | No crystal structure; AI-predicted bound complex | | Protein Binder Design | `submit_protein_binder_design_workflow` | De novo binder generation against a protein target | ### Advanced computational chemistry | Workflow | Function | When to use | |----------|----------|-------------| | Basic Calculation | `submit_basic_calculation_workflow` | QM/ML geometry optimization or single-point energy | | Electronic Properties | `submit_electronic_properties_workflow` | Dipole, partial charges, HOMO-LUMO, ESP | | BDE | `submit_bde_workflow` | Bond dissociation energies; metabolic soft-spot prediction | | Redox Potential | `submit_redox_potential_workflow` | Oxidation/reduction potentials | | Spin States | `submit_spin_states_workflow` | Spin-state energy ordering for organometallics/radicals | | Strain | `submit_strain_workflow` | Conformational strain relative to global minimum | | Scan | `submit_scan_workflow` | PES scans; torsion profiles | | Multistage Optimization | `submit_multistage_opt_workflow` | Progressive optimization across levels of theory | ### Reaction chemistry | Workflow | Function | When to use | |----------|----------|-------------| | Double-Ended TS Search | `submit_double_ended_ts_search_workflow` | Transition state between two known structures | | IRC | `submit_irc_workflow` | Confirm TS connectivity; intrinsic reaction coordinate | ### Advanced properties | Workflow | Function | When to use | |----------|----------|-------------| | NMR | `submit_nmr_workflow` | Predicted 1H/13C chemical shifts for structure verification | | Ion Mobility | `submit_ion_mobility_workflow` | Collision cross-section (CCS) for MS method development | | Hydrogen Bond Strength | `submit_hydrogen_bond_basicity_workflow` | H-bond donor/acceptor strength for formulation/solubility | | Fukui | `submit_fukui_workflow` | Site reactivity indices for electrophilic/nucleophilic attack | | Interaction Energy Decomposition | `submit_interaction_energy_decomposition_workflow` | Fragment-level interaction analysis | ### Binding free energy | Workflow | Function | When to use | |----------|----------|-------------| | RBFE/FEP | `submit_relative_binding_free_energy_perturbation_workflow` | Relative ΔΔG for congeneric series | | RBFE Graph | `submit_rbfe_graph_workflow` | Build and optimize an RBFE perturbation network | ### Sequence and structural biology | Workflow | Function | When to use | |----------|----------|-------------| | MSA | `submit_msa_workflow` | Multiple sequence alignment for cofolding (ColabFold, Chai, Boltz) | | Solvent-Dependent Conformers | `submit_solvent_dependent_conformers_workflow` | Solvation-aware conformer ensembles | ## Batch submission and retrieval For libraries or analogue series, submit in a loop using the specific workflow function. The generic `rowan.batch_submit_workflow()` and `rowan.submit_workflow()` functions currently return 422 errors from the API — use the named functions (`submit_descriptors_workflow`, `submit_pka_workflow`, etc.) instead. ### Submit a batch ```python smileses = ["CCO", "CC(=O)O", "c1ccccc1O"] names = ["ethanol", "acetic acid", "phenol"] workflows = [ rowan.submit_descriptors_workflow(smi, name=name) for smi, name in zip(smileses, names) ] print(f"Submitted {len(workflows)} workflows") ``` ### Poll batch status ```python statuses = rowan.batch_poll_status([wf.uuid for wf in workflows]) # Returns aggregate counts — not per-UUID: # {'queued': 0, 'running': 1, 'complete': 2, 'failed': 0, 'total': 3, ...} if statuses["complete"] == statuses["total"]: print("All workflows done") elif statuses["failed"] > 0: print(f"{statuses['failed']} workflows failed") ``` ### Retrieve and collect results ```python results = [] for wf in workflows: try: result = wf.result() results.append(result.data) except rowan.WorkflowError as e: print(f"Workflow {wf.uuid} failed: {e}") # Optionally aggregate into DataFrame import pandas as pd df = pd.DataFrame(results) ``` ### Non-blocking / fire-and-check pattern For long-running workflows where you don't want to hold a process open, submit workflows, save their UUIDs, and check back later in a separate process. **Session 1 — submit and save UUIDs:** ```python import rowan, json rowan.api_key = "..." smileses = ["CCO", "CC(=O)O", "c1ccccc1O"] workflows = [ rowan.submit_descriptors_workflow(smi, name=f"compound_{i}") for i, smi in enumerate(smileses) ] # Save UUIDs to disk (or a database) uuids = [wf.uuid for wf in workflows] with open("workflow_uuids.json", "w") as f: json.dump(uuids, f) print("Submitted. Check back later.") ``` **Session 2 — check status and collect results when ready:** ```python import rowan, json rowan.api_key = "..." with open("workflow_uuids.json") as f: uuids = json.load(f) results = [] for uuid in uuids: wf = rowan.retrieve_workflow(uuid) if wf.done(): result = wf.result(wait=False) results.append({"uuid": uuid, "data": result.data}) else: print(f"{uuid}: still running ({wf.status})") print(f"Collected {len(results)} completed results") ``` ## Webhooks and asynchronous workflows For long-running campaigns or when you don't want to keep a process alive, use webhooks to notify your backend when workflows complete. ### Setting up webhooks Every workflow submission function accepts a `webhook_url` parameter: ```python wf = rowan.submit_docking_workflow( protein=protein, pocket=pocket, initial_molecule="CCO", webhook_url="https://myserver.com/rowan_callback", name="docking with webhook", ) print(f"Workflow submitted. Result will be POSTed to webhook when complete.") ``` Webhook URLs can be passed to any specific workflow function (`submit_docking_workflow()`, `submit_pka_workflow()`, `submit_descriptors_workflow()`, etc.). ### Webhook authentication with secrets Rowan supports webhook signature verification to ensure requests are authentic. You'll need to: 1. **Create or retrieve a webhook secret:** ```python import rowan # Create a new webhook secret secret = rowan.create_webhook_secret() print(f"Your webhook secret: {secret.secret}") # Or retrieve an existing secret secret = rowan.get_webhook_secret() # Rotate your secret (invalidates old one, creates new) new_secret = rowan.rotate_webhook_secret() ``` 2. **Verify incoming webhook requests:** ```python import rowan import hmac import json def verify_webhook(request_body: bytes, signature: str, secret: str) -> bool: """Verify the HMAC-SHA256 signature of a webhook request.""" return rowan.verify_webhook_secret(request_body, signature, secret) ``` ### Webhook payload and signature When a workflow completes, Rowan POSTs a JSON payload to your webhook URL with the header: ```text X-Rowan-Signature: ``` The request body contains the complete workflow result: ```json { "workflow_uuid": "wf_12345abc", "workflow_type": "docking", "workflow_name": "lead docking", "status": "COMPLETED_OK", "created_at": "2025-04-01T12:00:00Z", "completed_at": "2025-04-01T12:15:30Z", "data": { "scores": [-8.2, -8.0, -7.9], "best_pose": {...}, "metadata": {...} } } ``` ### Example webhook handler with signature verification (FastAPI) ```python from fastapi import FastAPI, Request, HTTPException import rowan import json app = FastAPI() _ws = rowan.get_webhook_secret() or rowan.create_webhook_secret() webhook_secret = _ws.secret @app.post("/rowan_callback") async def handle_rowan_webhook(request: Request): # Get request body and signature body = await request.body() signature = request.headers.get("X-Rowan-Signature") if not signature: raise HTTPException(status_code=400, detail="Missing X-Rowan-Signature header") # Verify signature if not rowan.verify_webhook_secret(body, signature, webhook_secret): raise HTTPException(status_code=401, detail="Invalid webhook signature") # Parse and process payload = json.loads(body) wf_uuid = payload["workflow_uuid"] status = payload["status"] if status == "COMPLETED_OK": print(f"Workflow {wf_uuid} succeeded!") result_data = payload["data"] # Process result, update database, trigger next workflow, etc. elif status == "FAILED": print(f"Workflow {wf_uuid} failed!") # Handle failure # Respond quickly to prevent retries return {"status": "received"} ``` ### Webhook best practices - **Always verify signatures** using `rowan.verify_webhook_secret()` to ensure requests are from Rowan - **Respond quickly** (< 5 seconds); offload heavy processing to async tasks or background jobs - **Implement idempotency**: workflows may retry; handle duplicate payloads gracefully using `workflow_uuid` - **Log all events** for debugging and audit trails - **Use for long campaigns**: webhooks shine with 50+ workflows; for small jobs, polling with `result()` is simpler - **Rotate secrets regularly** using `rowan.rotate_webhook_secret()` for security - **Return 2xx status** to confirm receipt; Rowan may retry on 5xx errors ## Protein utilities ### Upload proteins ```python # From local PDB file protein = rowan.upload_protein( name="egfr_kinase_domain", file_path="egfr_kinase.pdb", ) # From PDB database protein_from_pdb = rowan.create_protein_from_pdb_id( name="CDK2 (1M17)", code="1M17", ) # Retrieve previously uploaded protein protein = rowan.retrieve_protein("protein-uuid") # List all proteins my_proteins = rowan.list_proteins() ``` ### Protein preparation guidance - **File format**: PDB, mmCIF (Rowan auto-detects) - **Water molecules**: Rowan usually keeps relevant water; remove bulk water beforehand if desired - **Heteroatoms**: Cofactors, ions, and bound ligands are usually preserved; remove unwanted heteroatoms before upload - **Multi-chain proteins**: Fully supported - **Resolution**: Works with NMR structures, homology models, and cryo-EM; quality matters for downstream predictions - **Validation**: Rowan validates PDB syntax; severely malformed files may be rejected ## End-to-end example: Lead optimization campaign This example demonstrates a realistic workflow for optimizing a hit compound: ```python import rowan import pandas as pd # 1. Create a project and folder for organization project = rowan.create_project(name="CDK2 Hit Optimization") rowan.set_project("CDK2 Hit Optimization") folder = rowan.create_folder(name="round_1_tautomers_and_pka") # 2. Load hit compound and analogues hit = "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1" # Known hit analogues = [ "CCNc1ncc(c(Nc2ccccc2)n1)-c1cccnc1", # Remove F "CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1", # Cl instead of F "CCC(C)Nc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", # Propyl instead of ethyl ] # 3. Determine best tautomers (just in case) print("Searching tautomeric forms...") taut_workflows = [ rowan.submit_tautomer_search_workflow( smi, name=f"analog_{i}", folder=folder, ) for i, smi in enumerate(analogues) ] best_tautomers = [] for wf in taut_workflows: result = wf.result() best_tautomers.append(result.best_tautomer) # 4. Predict pKa and basic properties for all analogues print("Predicting pKa and properties...") pka_workflows = [ rowan.submit_pka_workflow( smi, method="chemprop_nevolianis2025", name=f"pka_{i}", folder=folder, ) for i, smi in enumerate(best_tautomers) ] descriptor_workflows = [ rowan.submit_descriptors_workflow(smi, name=f"desc_{i}", folder=folder) for i, smi in enumerate(best_tautomers) ] # 5. Collect results pka_results = [] for wf in pka_workflows: try: result = wf.result() pka_results.append({ "compound": wf.name, "pka": result.strongest_acid, # pKa of the strongest acid site "uuid": wf.uuid, }) except rowan.WorkflowError as e: print(f"pKa prediction failed for {wf.name}: {e}") descriptor_results = [] for wf in descriptor_workflows: try: result = wf.result() desc = result.descriptors descriptor_results.append({ "compound": wf.name, "mw": desc.get("MW"), "logp": desc.get("SLogP"), "hba": desc.get("nHBAcc"), "hbd": desc.get("nHBDon"), "uuid": wf.uuid, }) except rowan.WorkflowError as e: print(f"Descriptor calculation failed for {wf.name}: {e}") # 6. Merge and summarize df_pka = pd.DataFrame(pka_results) df_desc = pd.DataFrame(descriptor_results) df = df_pka.merge(df_desc, on="compound", how="outer") print("\n=== Preliminary SAR ===") print(df.to_string()) # 7. Select promising compound for docking # compound names are "pka_0", "pka_1", etc. — extract index to look up SMILES top_idx = int(df.loc[df["pka"].idxmin(), "compound"].split("_")[1]) top_smiles = best_tautomers[top_idx] print(f"\nProceeding with docking: {top_smiles}") # 8. Docking campaign protein = rowan.create_protein_from_pdb_id(name="CDK2_1CKP", code="1CKP") pocket = {"center": [10.5, 24.2, 31.8], "size": [18.0, 18.0, 18.0]} docking_wf = rowan.submit_docking_workflow( protein=protein, pocket=pocket, initial_molecule=top_smiles, do_pose_refinement=True, name=f"docking_{top_compound}", ) dock_result = docking_wf.result() print(f"\nDocking score: {dock_result.scores[0]:.2f} kcal/mol") print(f"Best pose saved to: best_pose.pdb") dock_result.best_pose.write("best_pose.pdb") ``` ## Error handling and troubleshooting ### Common errors and solutions ```python import rowan # Error 1: Invalid SMILES try: wf = rowan.submit_descriptors_workflow("CCCC(CC", name="bad smiles") # Invalid except rowan.ValidationError as e: print(f"Invalid SMILES: {e}") # Solution: Use RDKit to validate before submission from rdkit import Chem smi = Chem.MolToSmiles(Chem.MolFromSmiles(smi)) # Error 2: API key not set try: wf = rowan.submit_descriptors_workflow("CCO") except rowan.AuthenticationError: print("API key not found. Set ROWAN_API_KEY env var or call rowan.api_key = '...'") # Error 3: Insufficient credits try: wf = rowan.submit_protein_cofolding_workflow(...) except rowan.InsufficientCreditsError as e: print(f"Not enough credits: {e}. Purchase more or reduce job size.") # Error 4: Workflow failed (bad molecule, etc.) try: wf = rowan.submit_docking_workflow(...) result = wf.result() except rowan.WorkflowError as e: print(f"Workflow failed: {e}") # Check wf.status for details print(f"Status: {wf.status}") # Error 5: Workflow not yet done — poll manually result = wf.result(wait=True, poll_interval=5) # waits and polls every 5s # Or check status without blocking: if not wf.done(): print("Workflow still running. Call wf.result() again later.") ``` ### Debugging tips - **Check workflow status**: `wf.status`, check `wf.done()`, or call `wf.get_status()` - **Inspect raw result**: `result.data` instead of convenience properties - **Re-run failed workflow**: Save UUIDs and retry with `rowan.retrieve_workflow(uuid)` - **Validate molecules beforehand**: Use RDKit or Chemaxon before batch submission ## Recommended usage patterns - **Prefer Rowan-native workflows** over low-level assembly when they exist - **Use projects and folders** for any nontrivial campaign (>5 workflows) - **Use `result()` to block until complete** (default: `wait=True, poll_interval=5`) - **Use typed result properties first**, fall back to `.data` for unmapped fields - **Use batch submission** for compound libraries or analogue series - **Chain workflows** for multi-step chemistry campaigns: - `pKa → macropKa → permeability` (ADME assessment) - `tautomer search → docking → pose-analysis MD` (pose refinement) - `MSA generation → protein-ligand cofolding` (AI structure prediction) - **Use webhooks** for long-running campaigns (>50 workflows) or asynchronous pipelines - **Use streaming** for interactive feedback on large conformer/docking searches ## Summary Use Rowan when your workflow requires cloud execution for molecular-design tasks, especially when you want one unified API and consistent result handling across small-molecule modeling, proteins, docking, ADME prediction, and ML structure generation. Rowan is a molecular-design workflow platform, not just a remote chemistry engine. It handles infrastructure scaling, result persistence, and multi-step pipeline orchestration so you can focus on science.