--- title: "Tamarind Bio — validated examples & output shapes" task: "" lineage_type: import upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/0807ddbc/skills/tamarind/references/examples.md upstream_sha: 0807ddbc imported_at: 2026-06-30 prompt_class: prompt upstream_changes: accepted author: upstream validated: false --- # Tamarind Bio — validated examples & output shapes **The freshest example for any tool is the `exampleJob` field MCP `getJobSchema()` now returns** — an `{jobName, type, settings}` built from each param's example/default (with an `exampleJobNote`; org-gated params you can't use are omitted, file params get placeholder filenames). It's the best starting point, but **run `validateJob` on it before submitting** — it's assembled from per-param examples, not a guaranteed-valid payload, so a given tool's `exampleJob` can need a tweak. The payloads below are a `validateJob`-confirmed fallback for REST callers or when you want a worked example. Tool schemas evolve — if one stops validating, re-fetch with `getJobSchema()` / `GET /tools`. Sequences here are illustrative; swap your own. **File params (`proteinFile`, `pdbFile`, `ligandFile`, …) need a real file value** — either the **bare filename** of an uploaded file (`target.pdb` — NOT email-prefixed), a prior-job output **path** (`JobName/out/x.pdb`), or **inline PDB/SDF-format text** (multi-line `ATOM`/`HETATM` records). The `<...>` placeholders below are NOT valid as written — replace them. **Do not put an amino-acid sequence in a file param** — `validateJob` rejects it with `File ... must be of types: ["pdb"]`. (A sequence goes in `sequence`, a structure goes in a file param.) `BASE = "https://app.tamarind.bio/api"`, `HEADERS = {"x-api-key": }`. ## Self-check (run this first to confirm the skill works for you) Read-only + dry-run, no submission, no cost. Confirms the discover → schema → validate loop end-to-end: ```python import os, requests BASE, HEADERS = "https://app.tamarind.bio/api", {"x-api-key": os.environ["TAMARIND_API_KEY"]} # 1. discovery reachable? tools = requests.get(f"{BASE}/tools", headers=HEADERS).json() assert isinstance(tools, list) and any(t["name"] == "alphafold" for t in tools), "tools endpoint" # 2. validate a known-good payload (MCP validateJob; or skip if REST-only) # expect {"valid": true, ...} ``` With the MCP server: `validateJob(jobName="selfcheck", type="alphafold", settings={"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIE"})` → `valid: true`. ## Validated input payloads ### AlphaFold — monomer ```json { "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKR", "numModels": "1", "numRecycles": 3 } ``` Only `sequence` is required; everything else has a default. `numModels` is a string dropdown (`"1"`–`"5"`). ### AlphaFold — multimer (colon-separated chains) ```json { "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIE:DIQMTQSPSSLSASVGDRVTITCRASQSISSYLN" } ``` Join chains with `:`. No separate "multimer" flag — chain count drives it. ### Boltz-2 — sequence mode ```json { "inputFormat": "sequence", "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALP" } ``` `inputFormat` is **required** (`"sequence"` / `"list"` / `"molecules"` / `"yaml"`). Omitting it fails — see "What fails" below. ### DiffDock — protein + SMILES ligand ```json { "ligandFormat": "SMILES", "ligandSmiles": "CC(=O)Oc1ccccc1C(=O)O", "proteinFile": "" } ``` `ligandFormat` chooses the conditional field: `"SMILES"` → `ligandSmiles`; `"sdf/mol2 file"` → `ligandFile`. `proteinFile` is a file param — pass an uploaded file's bare filename (`target.pdb`, not email-prefixed), a prior-job path (`JobName/...`), or inline PDB text (see file-input rules in `api_reference.md`). ### Autodock Vina — protein + SMILES ligand (classical docking into a pocket) ```json { "receptorFile": "receptor.pdb", "ligandFormat": "smiles", "ligandSmiles": "CC(=O)Oc1ccccc1C(=O)O", "boxX": 15.19, "boxY": 53.903, "boxZ": 16.917, "width": 20, "height": 20, "depth": 20 } ``` Unlike DiffDock, Autodock Vina docks into a **fixed pocket**, so it requires a bounding box (`boxX/Y/Z` center + `width/height/depth`, all required) and the receptor in `receptorFile` (not `proteinFile`). Its `ligandFormat` enum is **lowercase** (`"smiles"` / `"sdf"`) — different from DiffDock's `"SMILES"` / `"sdf/mol2 file"`, so don't copy DiffDock's value across. `exhaustiveness` (default 8) is optional. `validateJob`-confirmed. ### ProteinMPNN — design residues on a backbone ```json { "pdbFile": "", "designedResidues": { "A": "1 2 3 4 5" }, "numSequences": 4, "modelType": "proteinmpnn" } ``` Requires `pdbFile` + `designedResidues` (per-chain, space-separated resnums). `modelType` ∈ `proteinmpnn`/`ligandmpnn`/`solublempnn`/`hypermpnn`/`abmpnn`. Note `designedChains` is `exclude:["api"]` — don't send it over the API. ### Batch (same tool, many jobs) ```json { "batchName": "screen-1", "type": "alphafold", "jobNames": ["s1", "s2"], "settings": [ { "sequence": "MKT..." }, { "sequence": "AVF..." } ] } ``` ## What fails (and the exact error) — confirmed live - **Boltz without `inputFormat`** → `valid:false`, `Missing required boltz field "inputFormat"`. Always check required fields with `getJobSchema` first; `sequence` alone is not enough for boltz/chai. - **Building a submit from `validateJob`'s `normalized` blob** — `normalized` is informational (defaults filled in, sometimes platform-managed fields). Submit the clean `settings` you validated, not the normalized echo. - **File param given a bare string that isn't a real path** → treated as INLINE file content (uploaded as `/-.`), not a reference. To point at an existing uploaded file use its **bare filename** (`target.pdb` — do NOT email-prefix it; `{email}/{filename}` is the S3 key and 400s as not-uploaded), or `JobName/...` for a prior job's output. Referencing a path that doesn't exist → `File ... has not been uploaded`. ## Output shapes (describe, don't expect exact values) Outputs are non-deterministic (seed/model/MSA) — reason about the *shape*, not golden numbers. - **Job row `Score`** (JSON string on completed jobs): tool-family dependent. - Folding (alphafold/boltz/chai/esmfold): `plddt`, `ptm`, and for complexes `iptm` plus interface metrics (`ipSAE_*`, `pDockQ_*`). Higher pLDDT/pTM = more confident; iptm/ipSAE gauge interface quality. - Other families carry their own metrics — read the keys, don't assume. - **Results zip** (`POST /result` → presigned URL → GET): per-tool, typically the structure files (`rank_*.pdb` / `*.cif`), a scores CSV, and logs. Use `listJobFiles(jobName)` (MCP) to enumerate exact filenames before downloading. - **`WeightedHours`** on the row is the billing unit (see `usage-statistics`). To learn a specific tool's exact outputs, run one small job and `listJobFiles` it — don't hardcode filenames, which vary by tool and version.