[Upstream sync] K-Dense-AI/scientific-agent-skills (github) — 0 added, 8 modified #57

Open
promptadmin wants to merge 8 commits from upstream-sync/scientific-agent-skills-20260829-72d742-nlvh into main
8 changed files with 935 additions and 781 deletions
@@ -0,0 +1,321 @@
---
title: "Rowan Workflow Catalog"
task: ""
lineage_type: import
upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/72d742e1/skills/rowan/references/workflow_catalog.md
upstream_sha: 72d742e1
imported_at: 2026-08-29
prompt_class: unknown
upstream_changes: accepted
author: upstream
validated: false
---
# Rowan Workflow Catalog
Submission code, options, and result shapes for the common workflow categories, followed
by the complete list of supported workflow types.
## Common workflow categories
### 1. Descriptors
A lightweight entry point for batch triage, SAR, or exploratory scripts.
```python
wf = rowan.submit_descriptors_workflow(
rowan.Molecule.from_smiles("CC(=O)Oc1ccccc1C(=O)O"),
name="aspirin descriptors",
)
result = wf.result()
print(result.descriptors["MW"]) # 180.042 — exact mass
print(result.descriptors["SLogP"]) # 1.31
print(result.descriptors["TopoPSA"]) # 63.6 — topological PSA
print(result.descriptors["nHBAcc"]) # 3.0
```
**Common descriptor keys:**
| Key | Description | Typical drug range |
|-----|-------------|-------------------|
| `MW` | Exact/monoisotopic mass (Da), not average MW | <500 (Lipinski) |
| `SLogP` | Calculated LogP (lipophilicity) | -2 to +5 |
| `TopoPSA` | Topological polar surface area (Ų) | <140 for oral bioavailability |
| `TPSA` | 3D charged surface area, not topological PSA | — |
| `nHBDon` | H-bond donor count | ≤5 (Lipinski) |
| `nHBAcc` | H-bond acceptor count | ≤10 (Lipinski) |
| `nRot` | Rotatable bond count | <10 for oral drugs |
| `nRing` | Ring count | — |
| `nHeavyAtom` | Heavy atom count | — |
| `FilterItLogS` | Estimated aqueous solubility (LogS) | >-4 preferred |
| `Lipinski` | Lipinski Ro5 pass (1.0) or fail (0.0) | — |
The result contains about 1,679 molecular descriptors in SDK 3.1.13 (BCUT,
GETAWAY, WHIM, etc.); access any via `result.descriptors["key"]`. For average
molecular weight, calculate it separately (for example, RDKit `MolWt`).
### 2. Microscopic pKa
For protonation-state energetics and acid/base behavior of a specific structure.
Four methods are available:
| Method | Input | Speed | Covers | Use when |
|--------|-------|-------|--------|----------|
| `chemprop_nevolianis2025` | SMILES string | Fast | Deprotonation only | Acidic groups only; quick screening |
| `starling` | SMILES string | Fast | Acid + base | Most drug-like molecules; preferred SMILES method |
| `aimnet2_wagen2024` | 3D molecule object | Slower | Acid + base | You already have a 3D structure |
| `gxtb_wagen2026` (**default**) | 3D molecule object | Slower | Acid + base | Current SDK default; set `method=` explicitly for reproducibility |
```python
# Fast path: SMILES input with full acid+base coverage (use starling method when available)
wf = rowan.submit_pka_workflow(
initial_molecule="c1ccccc1O", # phenol SMILES; param is initial_molecule, not initial_smiles
method="starling", # fast SMILES method, covers acid+base; chemprop_nevolianis2025 is deprotonation-only
name="phenol pKa",
)
result = wf.result()
print(result.strongest_acid) # 9.995 for phenol (verified; literature ~9.95)
print(result.strongest_base) # None when no basic site is found
print(result.conjugate_bases) # list of pKaMicrostate objects
# Access each microstate with .pka, .smiles, .atom_index, .delta_g, .uncertainty
```
### 3. MacropKa
For pH-dependent protonation behavior across a range.
```python
wf = rowan.submit_macropka_workflow(
initial_smiles="CN1CCN(CC1)C2=NC=NC3=CC=CC=C32", # imidazole
min_pH=0,
max_pH=14,
min_charge=-2, # default
max_charge=2, # default
compute_aqueous_solubility=True, # default
name="imidazole macropKa",
)
result = wf.result()
print(result.pka_values) # list of pKa values
print(result.logd_by_ph) # dict of {pH: logD}
print(result.aqueous_solubility_by_ph) # dict of {pH: solubility}
print(result.isoelectric_point) # isoelectric point
print(result.data)
# {'pKa_values': [...], 'logD_by_pH': {...}, 'aqueous_solubility_by_pH': {...}, ...}
```
### 4. Conformer search
For 3D ensemble generation when ensemble quality matters.
```python
wf = rowan.submit_conformer_search_workflow(
initial_molecule="CCOC(=O)N1CCC(CC1)Oc1ncnc2ccccc12",
name="conformer search",
)
result = wf.result()
print(result.num_conformers)
print(result.get_energies()) # [0.0, 1.2, 2.5, ...]
print(result.get_conformers()) # list of 3D molecules
print(result.get_conformer(0)) # lowest-energy conformer
# There is no num_conformers submit parameter. Configure the generator and
# ensemble through conf_gen_settings.
```
### 5. Tautomer search
For heterocycles and systems where tautomer state affects downstream modeling.
```python
wf = rowan.submit_tautomer_search_workflow(
initial_molecule=rowan.Molecule.from_smiles("O=c1[nH]ccnc1"),
name="imidazolone tautomers",
)
result = wf.result()
print(result.best_tautomer) # Most stable SMILES string
print(result.tautomers) # List of tautomeric SMILES
print(result.molecules) # List of molecule objects
```
### 6. Docking
For protein-ligand docking with optional pose refinement and conformer generation.
```python
# Upload protein once, reuse in multiple workflows
protein = rowan.upload_protein(
name="CDK2",
file_path="cdk2.pdb",
)
# Binding pocket: [[center_x, center_y, center_z], [size_x, size_y, size_z]] in Å
pocket = [[10.5, 24.2, 31.8], [18.0, 18.0, 18.0]]
# Submit docking
wf = rowan.submit_docking_workflow(
protein=protein,
pocket=pocket,
initial_molecule=rowan.Molecule.from_smiles(
"CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1"
),
do_pose_refinement=True,
do_csearch=True,
name="lead docking",
)
result = wf.result()
print(result.scores) # Docking scores (kcal/mol)
print(result.best_pose) # Mol object with 3D coordinates
print(result.data) # Raw result dict
```
**Protein preparation tips:**
- PDB files should be reasonably clean (remove water/heteroatoms unless intended)
- Use the same protein object across a docking series for consistency
- If you have a PDB ID, use `rowan.create_protein_from_pdb_id()` instead
### 7. Analogue docking
For placing a compound series into a shared binding context.
```python
# Analogue series (e.g., SAR campaign)
analogues = [
"CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", # reference
"CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1", # chloro
"CCNc1ncc(c(Nc2ccc(OC)cc2)n1)-c1cccnc1", # methoxy
"CCNc1ncc(c(Nc2cc(C)c(F)cc2)n1)-c1cccnc1", # methyl, fluoro
]
wf = rowan.submit_analogue_docking_workflow(
analogues=analogues,
initial_molecule=rowan.Molecule.from_smiles(analogues[0]), # reference ligand
protein=protein,
name="SAR series docking",
)
# Analogue docking does not accept a pocket parameter in SDK 3.1.13.
result = wf.result()
print(result.analogue_scores) # List of scores for each analogue
print(result.best_poses) # List of poses
```
### 8. MSA generation
For multiple-sequence alignment (useful for downstream cofolding).
```python
wf = rowan.submit_msa_workflow(
initial_protein_sequences=[
"MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP"
],
output_formats=["colabfold", "chai", "boltz"],
name="target MSA",
)
result = wf.result()
result.download_files() # Downloads alignments to disk
```
### 9. Protein-ligand cofolding
For AI-based bound-complex prediction when no crystal structure is available.
```python
wf = rowan.submit_protein_cofolding_workflow(
initial_protein_sequences=[
"MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP"
],
initial_smiles_list=[
"CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1"
],
name="protein-ligand cofolding",
)
result = wf.result()
print(result.predictions) # List of predicted structures
print(result.messages) # Model metadata/warnings
predicted_structure = result.get_predicted_structure()
predicted_structure.write("predicted_complex.pdb")
```
## All supported workflow types
All workflows follow the same submit → wait → retrieve pattern and support webhooks and project/folder organization.
### Core molecular modeling workflows
| Workflow | Function | When to use |
|----------|----------|-------------|
| Descriptors | `submit_descriptors_workflow` | First-pass triage: MW, LogP, TPSA, HBA/HBD, Lipinski filter |
| pKa | `submit_pka_workflow` | Single ionizable group; need protonation thermodynamics |
| MacropKa | `submit_macropka_workflow` | Multi-ionizable drugs; pH-dependent charge/LogD/solubility |
| Conformer Search | `submit_conformer_search_workflow` | 3D ensemble for docking, MD, or SAR; known tautomer |
| Tautomer Search | `submit_tautomer_search_workflow` | Heterocycles, keto–enol; uncertain tautomeric form |
| Solubility | `submit_solubility_workflow` | Aqueous or solvent-specific solubility prediction |
| Membrane Permeability | `submit_membrane_permeability_workflow` | Caco-2, PAMPA, BBB, plasma permeability |
| ADMET | `submit_admet_workflow` | Broad drug-likeness and ADMET property sweep |
### Structure-based design workflows
| Workflow | Function | When to use |
|----------|----------|-------------|
| Docking | `submit_docking_workflow` | Single ligand, known binding pocket |
| Analogue Docking | `submit_analogue_docking_workflow` | SAR series (5–100+ compounds) in a shared pocket |
| Batch Docking | `submit_batch_docking_workflow` | Fast library screening; large compound sets |
| Protein MD | `submit_protein_md_workflow` | Long-timescale dynamics; conformational sampling |
| Pose Analysis MD | `submit_pose_analysis_md_workflow` | MD refinement of a docking pose |
| Protein Cofolding | `submit_protein_cofolding_workflow` | No crystal structure; AI-predicted bound complex |
| Protein Binder Design | `submit_protein_binder_design_workflow` | De novo binder generation against a protein target |
### Advanced computational chemistry
| Workflow | Function | When to use |
|----------|----------|-------------|
| Basic Calculation | `submit_basic_calculation_workflow` | QM/ML geometry optimization or single-point energy |
| Electronic Properties | `submit_electronic_properties_workflow` | Dipole, partial charges, HOMO-LUMO, ESP |
| BDE | `submit_bde_workflow` | Bond dissociation energies; metabolic soft-spot prediction |
| Redox Potential | `submit_redox_potential_workflow` | Oxidation/reduction potentials |
| Spin States | `submit_spin_states_workflow` | Spin-state energy ordering for organometallics/radicals |
| Strain | `submit_strain_workflow` | Conformational strain relative to global minimum |
| Scan | `submit_scan_workflow` | PES scans; torsion profiles |
| Multistage Optimization | `submit_multistage_optimization_workflow` | Progressive optimization across levels of theory |
### Reaction chemistry
| Workflow | Function | When to use |
|----------|----------|-------------|
| Double-Ended TS Search | `submit_double_ended_ts_search_workflow` | Transition state between two known structures |
| IRC | `submit_irc_workflow` | Confirm TS connectivity; intrinsic reaction coordinate |
### Advanced properties
| Workflow | Function | When to use |
|----------|----------|-------------|
| NMR | `submit_nmr_workflow` | Predicted 1H/13C chemical shifts for structure verification |
| Ion Mobility | `submit_ion_mobility_workflow` | Collision cross-section (CCS) for MS method development |
| Hydrogen Bond Strength | `submit_hydrogen_bond_basicity_workflow` | H-bond donor/acceptor strength for formulation/solubility |
| Fukui | `submit_fukui_workflow` | Site reactivity indices for electrophilic/nucleophilic attack |
| Interaction Energy Decomposition | `submit_interaction_energy_decomposition_workflow` | Fragment-level interaction analysis |
### Binding free energy
| Workflow | Function | When to use |
|----------|----------|-------------|
| RBFE/FEP | `submit_relative_binding_free_energy_perturbation_workflow` | Relative ΔΔG for congeneric series |
| RBFE Graph | `submit_relative_binding_free_energy_graph_workflow` | Build and optimize an RBFE perturbation network |
### Sequence and structural biology
| Workflow | Function | When to use |
|----------|----------|-------------|
| MSA | `submit_msa_workflow` | Multiple sequence alignment for cofolding (ColabFold, Chai, Boltz) |
| Solvent-Dependent Conformers | `submit_solvent_dependent_conformers_workflow` | Solvation-aware conformer ensembles |
@@ -1,8 +1,8 @@
--- ---
lineage_type: import lineage_type: import
upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/9c9bd2e9/skills/stable-baselines3/SKILL.md upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/72d742e1/skills/stable-baselines3/SKILL.md
upstream_sha: 9c9bd2e9 upstream_sha: 72d742e1
imported_at: 2026-06-27 imported_at: 2026-08-29
prompt_class: unknown prompt_class: unknown
upstream_changes: accepted upstream_changes: accepted
name: stable-baselines3 name: stable-baselines3
@@ -10,7 +10,9 @@ description: Production-ready reinforcement learning algorithms (PPO, SAC, DQN,
license: MIT license license: MIT license
allowed-tools: Read Write Edit Bash allowed-tools: Read Write Edit Bash
compatibility: Requires Python 3.10+, PyTorch >= 2.3, and stable-baselines3 2.8+. Gymnasium environments; optional extras for TensorBoard and Atari (ale-py). compatibility: Requires Python 3.10+, PyTorch >= 2.3, and stable-baselines3 2.8+. Gymnasium environments; optional extras for TensorBoard and Atari (ale-py).
metadata: {"version": "1.1", "skill-author": "K-Dense Inc."} metadata:
version: "1.2"
skill-author: K-Dense Inc.
--- ---
# Stable Baselines3 # Stable Baselines3
@@ -1,16 +1,24 @@
--- ---
lineage_type: import lineage_type: import
upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/9c9bd2e9/skills/rowan/SKILL.md upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/72d742e1/skills/rowan/SKILL.md
upstream_sha: 9c9bd2e9 upstream_sha: 72d742e1
imported_at: 2026-06-27 imported_at: 2026-08-29
prompt_class: prompt prompt_class: prompt
upstream_changes: accepted upstream_changes: accepted
name: rowan name: rowan
description: Rowan is a cloud-native molecular modeling and medicinal-chemistry workflow platform with a Python API. Use for pKa and macropKa prediction, conformer and tautomer ensembles, docking and analogue docking, protein-ligand cofolding, MSA generation, molecular dynamics, permeability, descriptor workflows, and related small-molecule or protein modeling tasks. Ideal for programmatic batch screening, multi-step chemistry pipelines, and workflows that would otherwise require maintaining local HPC/GPU infrastructure. description: Rowan is a cloud-native molecular modeling and medicinal-chemistry workflow platform with a Python API. Use for pKa and macropKa prediction, conformer and tautomer ensembles, docking and analogue docking, protein-ligand cofolding, MSA generation, molecular dynamics, permeability, descriptor workflows, and related small-molecule or protein modeling tasks. Ideal for programmatic batch screening, multi-step chemistry pipelines, and workflows that would otherwise require maintaining local HPC/GPU infrastructure.
license: Proprietary (API key required) license: Proprietary (API key required)
compatibility: Python 3.12+, API key required compatibility: Python 3.12+, API key required
required_environment_variables: [{"name": "ROWAN_API_KEY", "prompt": "Rowan computational chemistry API key.", "required_for": "full functionality"}] metadata:
metadata: {"version": "1.2", "skill-author": "Rowan Science", "trigger-keywords": "pKa prediction, molecular docking, conformer search, chemistry workflow, drug discovery, SMILES, protein structure, batch molecular modeling, cloud chemistry", "openclaw": {"primaryEnv": "ROWAN_API_KEY", "envVars": [{"name": "ROWAN_API_KEY", "required": true, "description": "Rowan computational chemistry API key."}]}} version: "1.5"
skill-author: Rowan Science
trigger-keywords: pKa prediction, molecular docking, conformer search, chemistry workflow, drug discovery, SMILES, protein structure, batch molecular modeling, cloud chemistry
openclaw:
primaryEnv: ROWAN_API_KEY
envVars:
- name: ROWAN_API_KEY
required: true
description: Rowan computational chemistry API key.
--- ---
# Rowan: Cloud-Native Molecular-Modeling and Drug-Design Workflows # Rowan: Cloud-Native Molecular-Modeling and Drug-Design Workflows
@@ -37,40 +45,6 @@ Use Rowan when you want to run medicinal-chemistry or molecular-design workflows
- Simple molecular I/O (use RDKit directly) - Simple molecular I/O (use RDKit directly)
- Post-HF *ab initio* quantum chemistry or relativistic calculations - Post-HF *ab initio* quantum chemistry or relativistic calculations
## Access and pricing model
Rowan uses a credit-based usage model. All users, including free-tier users, can create API keys and use the Python API.
### Free-tier access
- Access to all Rowan core workflows
- 20 credits per week
- 500 signup credits
### Pricing and credit consumption
Credits are consumed according to compute type:
- **CPU**: 1 credit per minute
- **GPU**: 3 credits per minute
- **H100/H200 GPU**: 7 credits per minute
Purchased credits are priced per credit and remain valid for up to one year from purchase.
### Typical cost estimates
| Workflow | Typical Runtime | Estimated Credits | Notes |
|----------|----------------|-------------------|-------|
| Descriptors | <1 min | 0.5–2 | Lightweight, good for triage |
| pKa (single transition) | 2–5 min | 2–5 | Depends on molecule size |
| MacropKa (pH 0–14) | 5–15 min | 5–15 | Broader sampling, higher cost |
| Conformer search | 3–10 min | 3–10 | Ensemble quality matters |
| Tautomer search | 2–5 min | 2–5 | Heterocyclic systems |
| Docking (single ligand) | 5–20 min | 5–20 | Depends on pocket size, refinement |
| Analogue docking series (10–50 ligands) | 30–120 min | 30–100+ | Shared reference frame |
| MSA generation | 5–30 min | 5–30 | Sequence length dependent |
| Protein-ligand cofolding | 15–60 min | 20–50+ | AI structure prediction, GPU-heavy |
## Quick start ## Quick start
```bash ```bash
@@ -81,22 +55,24 @@ uv pip install rowan-python
import rowan import rowan
rowan.api_key = "your_api_key_here" # or set ROWAN_API_KEY env var rowan.api_key = "your_api_key_here" # or set ROWAN_API_KEY env var
# Submit a descriptors workflow — completes in under a minute # Descriptors require a 3D Molecule, not a bare SMILES string.
wf = rowan.submit_descriptors_workflow("CC(=O)Oc1ccccc1C(=O)O", name="aspirin") mol = rowan.Molecule.from_smiles("CC(=O)Oc1ccccc1C(=O)O")
wf = rowan.submit_descriptors_workflow(mol, name="aspirin")
result = wf.result() result = wf.result()
print(result.descriptors['MW']) # 180.16 print(result.descriptors["MW"]) # 180.042 — exact mass
print(result.descriptors['SLogP']) # 1.19 print(result.descriptors["SLogP"]) # 1.31
print(result.descriptors['TPSA']) # 59.44 print(result.descriptors["TopoPSA"]) # 63.6 — topological PSA
``` ```
If that prints without error, you're set up correctly. If that prints without error, you're set up correctly. These values and examples
were verified against `rowan-python` 3.1.13.
## Installation ## Installation
```bash ```bash
uv pip install rowan-python uv pip install rowan-python
# or: pip install rowan-python # or: uv pip install rowan-python
``` ```
## User and webhook management ## User and webhook management
@@ -122,33 +98,7 @@ Verify authentication:
import rowan import rowan
user = rowan.whoami() # Returns user info if authenticated user = rowan.whoami() # Returns user info if authenticated
print(f"User: {user.email}") print(f"User: {user.email}")
print(f"Credits available: {user.credits_available_string}") print(f"Credits available: {user.credits_available_string()}")
```
### Webhook secret management
For webhook signature verification, manage secrets through your user account:
```python
import rowan
# Get your current webhook secret (returns None if none exists)
secret = rowan.get_webhook_secret()
if secret is None:
secret = rowan.create_webhook_secret()
print(f"Secret key: {secret.secret}")
# Rotate your secret (invalidates old, creates new)
# Use this periodically for security
new_secret = rowan.rotate_webhook_secret()
print(f"New secret created (old secret disabled): {new_secret.secret}")
# Verify incoming webhook signatures
is_valid = rowan.verify_webhook_secret(
request_body=b"...", # Raw request body (bytes)
signature="X-Rowan-Signature", # From request header
secret=secret.secret
)
``` ```
## Molecule input formats ## Molecule input formats
@@ -159,7 +109,18 @@ Rowan accepts molecules in the following formats:
- **SMARTS patterns** (for some workflows): subset of SMARTS for substructure matching - **SMARTS patterns** (for some workflows): subset of SMARTS for substructure matching
- **InChI** (if supported in your API version): `"InChI=1S/C2H6O/c1-2-3/h3H,2H2,1H3"` - **InChI** (if supported in your API version): `"InChI=1S/C2H6O/c1-2-3/h3H,2H2,1H3"`
The API will validate input and raise a `rowan.ValidationError` if a molecule cannot be parsed. Always use canonicalized SMILES for reproducibility. The API validates molecule inputs and raises `ValueError` for an unparseable
SMILES or a workflow-incompatible input type. Always use canonicalized SMILES
for reproducibility.
### SMILES strings versus molecule objects
Accepted input types vary by workflow in `rowan-python` 3.1.13. Only these
common workflows accept a bare string: pKa, conformer search, membrane
permeability, ADMET, LogP, macropKa, solubility, and pose-analysis MD. Most
others — including descriptors, tautomer search, docking, analogue docking,
BDE, NMR, and Fukui — require `rowan.Molecule.from_smiles(smiles)` or an RDKit
`Mol`/`RWMol`. A wrong type raises `ValueError` before submission.
**Tip:** Use RDKit to validate SMILES before submission: **Tip:** Use RDKit to validate SMILES before submission:
@@ -184,21 +145,21 @@ import rowan
# 1. Submit — use the specific workflow function (not the generic submit_workflow) # 1. Submit — use the specific workflow function (not the generic submit_workflow)
workflow = rowan.submit_descriptors_workflow( workflow = rowan.submit_descriptors_workflow(
"CC(=O)Oc1ccccc1C(=O)O", rowan.Molecule.from_smiles("CC(=O)Oc1ccccc1C(=O)O"),
name="aspirin descriptors", name="aspirin descriptors",
) )
# 2. & 3. Wait and retrieve # 2. & 3. Wait and retrieve
result = workflow.result() # Blocks until done (default: wait=True, poll_interval=5) result = workflow.result() # Blocks until done (default: wait=True, poll_interval=5)
print(result.data) # Raw dict print(result.data) # Raw dict
print(result.descriptors['MW']) # 180.16 — use result.descriptors dict, not result.molecular_weight print(result.descriptors["MW"]) # 180.042 exact mass; no result.molecular_weight property
``` ```
For long-running workflows, use streaming: For long-running workflows, use streaming:
```python ```python
for partial in workflow.stream_result(poll_interval=5): for partial in workflow.stream_result(poll_interval=5):
print(f"Progress: {partial.complete}%") print(f"Complete: {partial.complete}") # bool, not a percentage
print(partial.data) print(partial.data)
``` ```
@@ -219,28 +180,30 @@ Rowan's API includes **typed workflow result objects** with convenience properti
Results have two access patterns: Results have two access patterns:
1. **Convenience properties** (recommended first): `result.descriptors`, `result.best_pose`, `result.conformer_energies` 1. **Convenience properties** (recommended first): `result.descriptors`, `result.best_pose`, `result.scores`. Result classes differ: conformer search uses `get_energies()` and `get_conformers()` methods.
2. **Raw fallback**: `result.data` — raw dictionary from the API 2. **Raw fallback**: `result.data` — raw dictionary from the API
Example: Example:
```python ```python
result = rowan.submit_descriptors_workflow( result = rowan.submit_descriptors_workflow(
"CCO", rowan.Molecule.from_smiles("CCO"),
name="ethanol", name="ethanol",
).result() ).result()
# Convenience property (returns dict of all descriptors): # Convenience property (returns all descriptors):
print(result.descriptors['MW']) # 46.042 print(result.descriptors["MW"]) # exact/monoisotopic mass
print(result.descriptors['SLogP']) # -0.001 print(result.descriptors["SLogP"])
print(result.descriptors['TPSA']) # 57.96 print(result.descriptors["TopoPSA"]) # usual topological PSA
# Raw data fallback (descriptors are nested under 'descriptors' key): # Raw data fallback:
print(result.data['descriptors']) print(result.data["descriptors"])
# {'MW': 46.042, 'SLogP': -0.001, 'TPSA': 57.96, 'nHBDon': 1.0, 'nHBAcc': 1.0, ...}
``` ```
**Note:** `DescriptorsResult` does **not** have a `molecular_weight` property. Descriptor keys use short names (`MW`, `SLogP`, `nHBDon`) not verbose names. **Note:** `DescriptorsResult` does **not** have a `molecular_weight` property.
`MW` is exact/monoisotopic mass, not average molecular weight. `TPSA` is a 3D
charged-surface descriptor; use `TopoPSA` for the usual topological polar
surface area used in drug-likeness rules.
### Cache invalidation ### Cache invalidation
@@ -248,7 +211,7 @@ Some result properties are lazily loaded (e.g., conformer geometries, protein st
```python ```python
result.clear_cache() result.clear_cache()
new_structures = result.conformer_molecules # Refetched new_structures = result.get_conformers() # Refetched for ConformerSearchResult
``` ```
## Projects, folders, and organization ## Projects, folders, and organization
@@ -265,11 +228,13 @@ project = rowan.create_project(name="CDK2 lead optimization")
rowan.set_project("CDK2 lead optimization") rowan.set_project("CDK2 lead optimization")
# All subsequent workflows go into this project # All subsequent workflows go into this project
wf = rowan.submit_descriptors_workflow("CCO", name="test compound") wf = rowan.submit_descriptors_workflow(
rowan.Molecule.from_smiles("CCO"), name="test compound"
)
# Retrieve later # retrieve_project takes a UUID; list_workflows scopes with parent_uuid.
project = rowan.retrieve_project("CDK2 lead optimization") project = rowan.retrieve_project(project.uuid)
workflows = rowan.list_workflows(project=project, size=50) workflows = rowan.list_workflows(parent_uuid=project.uuid, size=50)
``` ```
### Folders ### Folders
@@ -285,7 +250,7 @@ wf = rowan.submit_docking_workflow(
) )
# List workflows in a folder # List workflows in a folder
results = rowan.list_workflows(folder=folder) results = rowan.list_workflows(parent_uuid=folder.uuid)
``` ```
## Workflow decision trees ## Workflow decision trees
@@ -334,7 +299,7 @@ ADME assessment across GI pH: Use macropKa
```python ```python
# Step 1: Find best tautomer # Step 1: Find best tautomer
taut_wf = rowan.submit_tautomer_search_workflow( taut_wf = rowan.submit_tautomer_search_workflow(
initial_molecule="O=c1[nH]ccnc1", initial_molecule=rowan.Molecule.from_smiles("O=c1[nH]ccnc1"),
name="imidazole tautomers", name="imidazole tautomers",
) )
best_taut = taut_wf.result().best_tautomer best_taut = taut_wf.result().best_tautomer
@@ -354,528 +319,6 @@ conf_wf = rowan.submit_conformer_search_workflow(
| Analogue docking | 5–100+ related compounds | Protein + SMILES list + reference ligand | All poses, reference-aligned | | Analogue docking | 5–100+ related compounds | Protein + SMILES list + reference ligand | All poses, reference-aligned |
| Protein-ligand cofolding | Sequence + ligand, no crystal structure | Protein sequence + SMILES | ML-predicted bound complex | | Protein-ligand cofolding | Sequence + ligand, no crystal structure | Protein sequence + SMILES | ML-predicted bound complex |
## Common workflow categories
### 1. Descriptors
A lightweight entry point for batch triage, SAR, or exploratory scripts.
```python
wf = rowan.submit_descriptors_workflow(
"CC(=O)Oc1ccccc1C(=O)O", # positional arg, accepts SMILES string
name="aspirin descriptors",
)
result = wf.result()
print(result.descriptors['MW']) # 180.16
print(result.descriptors['SLogP']) # 1.19
print(result.descriptors['TPSA']) # 59.44
print(result.data['descriptors'])
# {'MW': 180.16, 'SLogP': 1.19, 'TPSA': 59.44, 'nHBDon': 1.0, 'nHBAcc': 4.0, ...}
```
**Common descriptor keys:**
| Key | Description | Typical drug range |
|-----|-------------|-------------------|
| `MW` | Molecular weight (Da) | <500 (Lipinski) |
| `SLogP` | Calculated LogP (lipophilicity) | -2 to +5 |
| `TPSA` | Topological polar surface area (Ų) | <140 for oral bioavailability |
| `nHBDon` | H-bond donor count | ≤5 (Lipinski) |
| `nHBAcc` | H-bond acceptor count | ≤10 (Lipinski) |
| `nRot` | Rotatable bond count | <10 for oral drugs |
| `nRing` | Ring count | — |
| `nHeavyAtom` | Heavy atom count | — |
| `FilterItLogS` | Estimated aqueous solubility (LogS) | >-4 preferred |
| `Lipinski` | Lipinski Ro5 pass (1.0) or fail (0.0) | — |
The result contains hundreds of additional molecular descriptors (BCUT, GETAWAY, WHIM, etc.); access any via `result.descriptors['key']`.
### 2. Microscopic pKa
For protonation-state energetics and acid/base behavior of a specific structure.
Two methods are available:
| Method | Input | Speed | Covers | Use when |
|--------|-------|-------|--------|----------|
| `chemprop_nevolianis2025` | SMILES string | Fast | Deprotonation only (anionic conjugate bases) | Acidic groups only; quick screening |
| `starling` | SMILES string | Fast | Acid + base (full protonation/deprotonation) | Most drug-like molecules; preferred SMILES method |
| `aimnet2_wagen2024` (default) | 3D molecule object | Slower, higher accuracy | Acid + base | You already have a 3D structure (e.g. from conformer search) |
```python
# Fast path: SMILES input with full acid+base coverage (use starling method when available)
wf = rowan.submit_pka_workflow(
initial_molecule="c1ccccc1O", # phenol SMILES; param is initial_molecule, not initial_smiles
method="starling", # fast SMILES method, covers acid+base; chemprop_nevolianis2025 is deprotonation-only
name="phenol pKa",
)
result = wf.result()
print(result.strongest_acid) # 9.81 (pKa of the most acidic site)
print(result.conjugate_bases) # list of {pka, smiles, atom_index, ...} per deprotonatable site
```
### 3. MacropKa
For pH-dependent protonation behavior across a range.
```python
wf = rowan.submit_macropka_workflow(
initial_smiles="CN1CCN(CC1)C2=NC=NC3=CC=CC=C32", # imidazole
min_pH=0,
max_pH=14,
min_charge=-2, # default
max_charge=2, # default
compute_aqueous_solubility=True, # default
name="imidazole macropKa",
)
result = wf.result()
print(result.pka_values) # list of pKa values
print(result.logd_by_ph) # dict of {pH: logD}
print(result.aqueous_solubility_by_ph) # dict of {pH: solubility}
print(result.isoelectric_point) # isoelectric point
print(result.data)
# {'pKa_values': [...], 'logD_by_pH': {...}, 'aqueous_solubility_by_pH': {...}, ...}
```
### 4. Conformer search
For 3D ensemble generation when ensemble quality matters.
```python
wf = rowan.submit_conformer_search_workflow(
initial_molecule="CCOC(=O)N1CCC(CC1)Oc1ncnc2ccccc12",
num_conformers=50, # Optional: override default
name="conformer search",
)
result = wf.result()
print(result.conformer_energies) # [0.0, 1.2, 2.5, ...]
print(result.conformer_molecules) # List of 3D molecules
print(result.best_conformer) # Lowest-energy conformer
```
### 5. Tautomer search
For heterocycles and systems where tautomer state affects downstream modeling.
```python
wf = rowan.submit_tautomer_search_workflow(
initial_molecule="O=c1[nH]ccnc1", # or keto tautomer
name="imidazolone tautomers",
)
result = wf.result()
print(result.best_tautomer) # Most stable SMILES string
print(result.tautomers) # List of tautomeric SMILES
print(result.molecules) # List of molecule objects
```
### 6. Docking
For protein-ligand docking with optional pose refinement and conformer generation.
```python
# Upload protein once, reuse in multiple workflows
protein = rowan.upload_protein(
name="CDK2",
file_path="cdk2.pdb",
)
# Define binding pocket
pocket = {
"center": [10.5, 24.2, 31.8],
"size": [18.0, 18.0, 18.0],
}
# Submit docking
wf = rowan.submit_docking_workflow(
protein=protein,
pocket=pocket,
initial_molecule="CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1",
do_pose_refinement=True,
do_conformer_search=True,
name="lead docking",
)
result = wf.result()
print(result.scores) # Docking scores (kcal/mol)
print(result.best_pose) # Mol object with 3D coordinates
print(result.data) # Raw result dict
```
**Protein preparation tips:**
- PDB files should be reasonably clean (remove water/heteroatoms unless intended)
- Use the same protein object across a docking series for consistency
- If you have a PDB ID, use `rowan.create_protein_from_pdb_id()` instead
### 7. Analogue docking
For placing a compound series into a shared binding context.
```python
# Analogue series (e.g., SAR campaign)
analogues = [
"CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", # reference
"CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1", # chloro
"CCNc1ncc(c(Nc2ccc(OC)cc2)n1)-c1cccnc1", # methoxy
"CCNc1ncc(c(Nc2cc(C)c(F)cc2)n1)-c1cccnc1", # methyl, fluoro
]
wf = rowan.submit_analogue_docking_workflow(
analogues=analogues,
initial_molecule=analogues[0], # Reference ligand
protein=protein,
pocket=pocket,
name="SAR series docking",
)
result = wf.result()
print(result.analogue_scores) # List of scores for each analogue
print(result.best_poses) # List of poses
```
### 8. MSA generation
For multiple-sequence alignment (useful for downstream cofolding).
```python
wf = rowan.submit_msa_workflow(
initial_protein_sequences=[
"MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP"
],
output_formats=["colabfold", "chai", "boltz"],
name="target MSA",
)
result = wf.result()
result.download_files() # Downloads alignments to disk
```
### 9. Protein-ligand cofolding
For AI-based bound-complex prediction when no crystal structure is available.
```python
wf = rowan.submit_protein_cofolding_workflow(
initial_protein_sequences=[
"MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVP"
],
initial_smiles_list=[
"CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1"
],
name="protein-ligand cofolding",
)
result = wf.result()
print(result.predictions) # List of predicted structures
print(result.messages) # Model metadata/warnings
predicted_structure = result.get_predicted_structure()
predicted_structure.write("predicted_complex.pdb")
```
## All supported workflow types
All workflows follow the same submit → wait → retrieve pattern and support webhooks and project/folder organization.
### Core molecular modeling workflows
| Workflow | Function | When to use |
|----------|----------|-------------|
| Descriptors | `submit_descriptors_workflow` | First-pass triage: MW, LogP, TPSA, HBA/HBD, Lipinski filter |
| pKa | `submit_pka_workflow` | Single ionizable group; need protonation thermodynamics |
| MacropKa | `submit_macropka_workflow` | Multi-ionizable drugs; pH-dependent charge/LogD/solubility |
| Conformer Search | `submit_conformer_search_workflow` | 3D ensemble for docking, MD, or SAR; known tautomer |
| Tautomer Search | `submit_tautomer_search_workflow` | Heterocycles, keto–enol; uncertain tautomeric form |
| Solubility | `submit_solubility_workflow` | Aqueous or solvent-specific solubility prediction |
| Membrane Permeability | `submit_membrane_permeability_workflow` | Caco-2, PAMPA, BBB, plasma permeability |
| ADMET | `submit_admet_workflow` | Broad drug-likeness and ADMET property sweep |
### Structure-based design workflows
| Workflow | Function | When to use |
|----------|----------|-------------|
| Docking | `submit_docking_workflow` | Single ligand, known binding pocket |
| Analogue Docking | `submit_analogue_docking_workflow` | SAR series (5–100+ compounds) in a shared pocket |
| Batch Docking | `submit_batch_docking_workflow` | Fast library screening; large compound sets |
| Protein MD | `submit_protein_md_workflow` | Long-timescale dynamics; conformational sampling |
| Pose Analysis MD | `submit_pose_analysis_md_workflow` | MD refinement of a docking pose |
| Protein Cofolding | `submit_protein_cofolding_workflow` | No crystal structure; AI-predicted bound complex |
| Protein Binder Design | `submit_protein_binder_design_workflow` | De novo binder generation against a protein target |
### Advanced computational chemistry
| Workflow | Function | When to use |
|----------|----------|-------------|
| Basic Calculation | `submit_basic_calculation_workflow` | QM/ML geometry optimization or single-point energy |
| Electronic Properties | `submit_electronic_properties_workflow` | Dipole, partial charges, HOMO-LUMO, ESP |
| BDE | `submit_bde_workflow` | Bond dissociation energies; metabolic soft-spot prediction |
| Redox Potential | `submit_redox_potential_workflow` | Oxidation/reduction potentials |
| Spin States | `submit_spin_states_workflow` | Spin-state energy ordering for organometallics/radicals |
| Strain | `submit_strain_workflow` | Conformational strain relative to global minimum |
| Scan | `submit_scan_workflow` | PES scans; torsion profiles |
| Multistage Optimization | `submit_multistage_opt_workflow` | Progressive optimization across levels of theory |
### Reaction chemistry
| Workflow | Function | When to use |
|----------|----------|-------------|
| Double-Ended TS Search | `submit_double_ended_ts_search_workflow` | Transition state between two known structures |
| IRC | `submit_irc_workflow` | Confirm TS connectivity; intrinsic reaction coordinate |
### Advanced properties
| Workflow | Function | When to use |
|----------|----------|-------------|
| NMR | `submit_nmr_workflow` | Predicted 1H/13C chemical shifts for structure verification |
| Ion Mobility | `submit_ion_mobility_workflow` | Collision cross-section (CCS) for MS method development |
| Hydrogen Bond Strength | `submit_hydrogen_bond_basicity_workflow` | H-bond donor/acceptor strength for formulation/solubility |
| Fukui | `submit_fukui_workflow` | Site reactivity indices for electrophilic/nucleophilic attack |
| Interaction Energy Decomposition | `submit_interaction_energy_decomposition_workflow` | Fragment-level interaction analysis |
### Binding free energy
| Workflow | Function | When to use |
|----------|----------|-------------|
| RBFE/FEP | `submit_relative_binding_free_energy_perturbation_workflow` | Relative ΔΔG for congeneric series |
| RBFE Graph | `submit_rbfe_graph_workflow` | Build and optimize an RBFE perturbation network |
### Sequence and structural biology
| Workflow | Function | When to use |
|----------|----------|-------------|
| MSA | `submit_msa_workflow` | Multiple sequence alignment for cofolding (ColabFold, Chai, Boltz) |
| Solvent-Dependent Conformers | `submit_solvent_dependent_conformers_workflow` | Solvation-aware conformer ensembles |
## Batch submission and retrieval
For libraries or analogue series, submit in a loop using the specific workflow function. The generic `rowan.batch_submit_workflow()` and `rowan.submit_workflow()` functions currently return 422 errors from the API — use the named functions (`submit_descriptors_workflow`, `submit_pka_workflow`, etc.) instead.
### Submit a batch
```python
smileses = ["CCO", "CC(=O)O", "c1ccccc1O"]
names = ["ethanol", "acetic acid", "phenol"]
workflows = [
rowan.submit_descriptors_workflow(smi, name=name)
for smi, name in zip(smileses, names)
]
print(f"Submitted {len(workflows)} workflows")
```
### Poll batch status
```python
statuses = rowan.batch_poll_status([wf.uuid for wf in workflows])
# Returns aggregate counts — not per-UUID:
# {'queued': 0, 'running': 1, 'complete': 2, 'failed': 0, 'total': 3, ...}
if statuses["complete"] == statuses["total"]:
print("All workflows done")
elif statuses["failed"] > 0:
print(f"{statuses['failed']} workflows failed")
```
### Retrieve and collect results
```python
results = []
for wf in workflows:
try:
result = wf.result()
results.append(result.data)
except rowan.WorkflowError as e:
print(f"Workflow {wf.uuid} failed: {e}")
# Optionally aggregate into DataFrame
import pandas as pd
df = pd.DataFrame(results)
```
### Non-blocking / fire-and-check pattern
For long-running workflows where you don't want to hold a process open, submit workflows, save their UUIDs, and check back later in a separate process.
**Session 1 — submit and save UUIDs:**
```python
import rowan, json
rowan.api_key = "..."
smileses = ["CCO", "CC(=O)O", "c1ccccc1O"]
workflows = [
rowan.submit_descriptors_workflow(smi, name=f"compound_{i}")
for i, smi in enumerate(smileses)
]
# Save UUIDs to disk (or a database)
uuids = [wf.uuid for wf in workflows]
with open("workflow_uuids.json", "w") as f:
json.dump(uuids, f)
print("Submitted. Check back later.")
```
**Session 2 — check status and collect results when ready:**
```python
import rowan, json
rowan.api_key = "..."
with open("workflow_uuids.json") as f:
uuids = json.load(f)
results = []
for uuid in uuids:
wf = rowan.retrieve_workflow(uuid)
if wf.done():
result = wf.result(wait=False)
results.append({"uuid": uuid, "data": result.data})
else:
print(f"{uuid}: still running ({wf.status})")
print(f"Collected {len(results)} completed results")
```
## Webhooks and asynchronous workflows
For long-running campaigns or when you don't want to keep a process alive, use webhooks to notify your backend when workflows complete.
### Setting up webhooks
Every workflow submission function accepts a `webhook_url` parameter:
```python
wf = rowan.submit_docking_workflow(
protein=protein,
pocket=pocket,
initial_molecule="CCO",
webhook_url="https://myserver.com/rowan_callback",
name="docking with webhook",
)
print(f"Workflow submitted. Result will be POSTed to webhook when complete.")
```
Webhook URLs can be passed to any specific workflow function (`submit_docking_workflow()`, `submit_pka_workflow()`, `submit_descriptors_workflow()`, etc.).
### Webhook authentication with secrets
Rowan supports webhook signature verification to ensure requests are authentic. You'll need to:
1. **Create or retrieve a webhook secret:**
```python
import rowan
# Create a new webhook secret
secret = rowan.create_webhook_secret()
print(f"Your webhook secret: {secret.secret}")
# Or retrieve an existing secret
secret = rowan.get_webhook_secret()
# Rotate your secret (invalidates old one, creates new)
new_secret = rowan.rotate_webhook_secret()
```
2. **Verify incoming webhook requests:**
```python
import rowan
import hmac
import json
def verify_webhook(request_body: bytes, signature: str, secret: str) -> bool:
"""Verify the HMAC-SHA256 signature of a webhook request."""
return rowan.verify_webhook_secret(request_body, signature, secret)
```
### Webhook payload and signature
When a workflow completes, Rowan POSTs a JSON payload to your webhook URL with the header:
```text
X-Rowan-Signature: <HMAC-SHA256 signature>
```
The request body contains the complete workflow result:
```json
{
"workflow_uuid": "wf_12345abc",
"workflow_type": "docking",
"workflow_name": "lead docking",
"status": "COMPLETED_OK",
"created_at": "2025-04-01T12:00:00Z",
"completed_at": "2025-04-01T12:15:30Z",
"data": {
"scores": [-8.2, -8.0, -7.9],
"best_pose": {...},
"metadata": {...}
}
}
```
### Example webhook handler with signature verification (FastAPI)
```python
from fastapi import FastAPI, Request, HTTPException
import rowan
import json
app = FastAPI()
_ws = rowan.get_webhook_secret() or rowan.create_webhook_secret()
webhook_secret = _ws.secret
@app.post("/rowan_callback")
async def handle_rowan_webhook(request: Request):
# Get request body and signature
body = await request.body()
signature = request.headers.get("X-Rowan-Signature")
if not signature:
raise HTTPException(status_code=400, detail="Missing X-Rowan-Signature header")
# Verify signature
if not rowan.verify_webhook_secret(body, signature, webhook_secret):
raise HTTPException(status_code=401, detail="Invalid webhook signature")
# Parse and process
payload = json.loads(body)
wf_uuid = payload["workflow_uuid"]
status = payload["status"]
if status == "COMPLETED_OK":
print(f"Workflow {wf_uuid} succeeded!")
result_data = payload["data"]
# Process result, update database, trigger next workflow, etc.
elif status == "FAILED":
print(f"Workflow {wf_uuid} failed!")
# Handle failure
# Respond quickly to prevent retries
return {"status": "received"}
```
### Webhook best practices
- **Always verify signatures** using `rowan.verify_webhook_secret()` to ensure requests are from Rowan
- **Respond quickly** (< 5 seconds); offload heavy processing to async tasks or background jobs
- **Implement idempotency**: workflows may retry; handle duplicate payloads gracefully using `workflow_uuid`
- **Log all events** for debugging and audit trails
- **Use for long campaigns**: webhooks shine with 50+ workflows; for small jobs, polling with `result()` is simpler
- **Rotate secrets regularly** using `rowan.rotate_webhook_secret()` for security
- **Return 2xx status** to confirm receipt; Rowan may retry on 5xx errors
## Protein utilities ## Protein utilities
### Upload proteins ### Upload proteins
@@ -909,167 +352,36 @@ my_proteins = rowan.list_proteins()
- **Resolution**: Works with NMR structures, homology models, and cryo-EM; quality matters for downstream predictions - **Resolution**: Works with NMR structures, homology models, and cryo-EM; quality matters for downstream predictions
- **Validation**: Rowan validates PDB syntax; severely malformed files may be rejected - **Validation**: Rowan validates PDB syntax; severely malformed files may be rejected
## End-to-end example: Lead optimization campaign ## Workflow catalog
This example demonstrates a realistic workflow for optimizing a hit compound: Nine common workflow categories — descriptors, microscopic pKa, MacropKa, conformer
search, tautomer search, docking, analogue docking, MSA generation, and protein-ligand
cofolding — each with submission code and result shapes, plus the complete list of every
supported workflow type (core modeling, structure-based design, advanced computational
chemistry, reaction chemistry, advanced properties, binding free energy, and sequence and
structural biology) are in
[references/workflow_catalog.md](references/workflow_catalog.md).
```python ## Batch submission, webhooks, and asynchronous work
import rowan
import pandas as pd
# 1. Create a project and folder for organization Batch submit/poll/retrieve, the non-blocking fire-and-check pattern, webhook setup,
project = rowan.create_project(name="CDK2 Hit Optimization") secret creation and rotation, payload and signature verification (with a FastAPI
rowan.set_project("CDK2 Hit Optimization") handler), and webhook best practices are in
folder = rowan.create_folder(name="round_1_tautomers_and_pka") [references/batch_and_webhooks.md](references/batch_and_webhooks.md).
# 2. Load hit compound and analogues ## Access, pricing, and credits
hit = "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1" # Known hit
analogues = [
"CCNc1ncc(c(Nc2ccccc2)n1)-c1cccnc1", # Remove F
"CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1", # Cl instead of F
"CCC(C)Nc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", # Propyl instead of ethyl
]
# 3. Determine best tautomers (just in case) Free-tier limits, credit consumption per workflow, and typical cost estimates are in
print("Searching tautomeric forms...") [references/access_and_pricing.md](references/access_and_pricing.md).
taut_workflows = [
rowan.submit_tautomer_search_workflow(
smi, name=f"analog_{i}", folder=folder,
)
for i, smi in enumerate(analogues)
]
best_tautomers = [] ## Worked example and troubleshooting
for wf in taut_workflows:
result = wf.result()
best_tautomers.append(result.best_tautomer)
# 4. Predict pKa and basic properties for all analogues A full lead-optimization campaign — project setup, tautomers, pKa across an analogue
print("Predicting pKa and properties...") series, result collection, and a docking follow-up — is in
pka_workflows = [ [references/end_to_end_example.md](references/end_to_end_example.md).
rowan.submit_pka_workflow(
smi, method="chemprop_nevolianis2025", name=f"pka_{i}", folder=folder,
)
for i, smi in enumerate(best_tautomers)
]
descriptor_workflows = [ Common errors with their fixes, and debugging tips, are in
rowan.submit_descriptors_workflow(smi, name=f"desc_{i}", folder=folder) [references/troubleshooting.md](references/troubleshooting.md).
for i, smi in enumerate(best_tautomers)
]
# 5. Collect results
pka_results = []
for wf in pka_workflows:
try:
result = wf.result()
pka_results.append({
"compound": wf.name,
"pka": result.strongest_acid, # pKa of the strongest acid site
"uuid": wf.uuid,
})
except rowan.WorkflowError as e:
print(f"pKa prediction failed for {wf.name}: {e}")
descriptor_results = []
for wf in descriptor_workflows:
try:
result = wf.result()
desc = result.descriptors
descriptor_results.append({
"compound": wf.name,
"mw": desc.get("MW"),
"logp": desc.get("SLogP"),
"hba": desc.get("nHBAcc"),
"hbd": desc.get("nHBDon"),
"uuid": wf.uuid,
})
except rowan.WorkflowError as e:
print(f"Descriptor calculation failed for {wf.name}: {e}")
# 6. Merge and summarize
df_pka = pd.DataFrame(pka_results)
df_desc = pd.DataFrame(descriptor_results)
df = df_pka.merge(df_desc, on="compound", how="outer")
print("\n=== Preliminary SAR ===")
print(df.to_string())
# 7. Select promising compound for docking
# compound names are "pka_0", "pka_1", etc. — extract index to look up SMILES
top_idx = int(df.loc[df["pka"].idxmin(), "compound"].split("_")[1])
top_smiles = best_tautomers[top_idx]
print(f"\nProceeding with docking: {top_smiles}")
# 8. Docking campaign
protein = rowan.create_protein_from_pdb_id(name="CDK2_1CKP", code="1CKP")
pocket = {"center": [10.5, 24.2, 31.8], "size": [18.0, 18.0, 18.0]}
docking_wf = rowan.submit_docking_workflow(
protein=protein,
pocket=pocket,
initial_molecule=top_smiles,
do_pose_refinement=True,
name=f"docking_{top_compound}",
)
dock_result = docking_wf.result()
print(f"\nDocking score: {dock_result.scores[0]:.2f} kcal/mol")
print(f"Best pose saved to: best_pose.pdb")
dock_result.best_pose.write("best_pose.pdb")
```
## Error handling and troubleshooting
### Common errors and solutions
```python
import rowan
# Error 1: Invalid SMILES
try:
wf = rowan.submit_descriptors_workflow("CCCC(CC", name="bad smiles") # Invalid
except rowan.ValidationError as e:
print(f"Invalid SMILES: {e}")
# Solution: Use RDKit to validate before submission
from rdkit import Chem
smi = Chem.MolToSmiles(Chem.MolFromSmiles(smi))
# Error 2: API key not set
try:
wf = rowan.submit_descriptors_workflow("CCO")
except rowan.AuthenticationError:
print("API key not found. Set ROWAN_API_KEY env var or call rowan.api_key = '...'")
# Error 3: Insufficient credits
try:
wf = rowan.submit_protein_cofolding_workflow(...)
except rowan.InsufficientCreditsError as e:
print(f"Not enough credits: {e}. Purchase more or reduce job size.")
# Error 4: Workflow failed (bad molecule, etc.)
try:
wf = rowan.submit_docking_workflow(...)
result = wf.result()
except rowan.WorkflowError as e:
print(f"Workflow failed: {e}")
# Check wf.status for details
print(f"Status: {wf.status}")
# Error 5: Workflow not yet done — poll manually
result = wf.result(wait=True, poll_interval=5) # waits and polls every 5s
# Or check status without blocking:
if not wf.done():
print("Workflow still running. Call wf.result() again later.")
```
### Debugging tips
- **Check workflow status**: `wf.status`, check `wf.done()`, or call `wf.get_status()`
- **Inspect raw result**: `result.data` instead of convenience properties
- **Re-run failed workflow**: Save UUIDs and retry with `rowan.retrieve_workflow(uuid)`
- **Validate molecules beforehand**: Use RDKit or Chemaxon before batch submission
## Recommended usage patterns ## Recommended usage patterns
@@ -0,0 +1,268 @@
---
title: "Batch Submission, Webhooks, and Asynchronous Workflows"
task: ""
lineage_type: import
upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/72d742e1/skills/rowan/references/batch_and_webhooks.md
upstream_sha: 72d742e1
imported_at: 2026-08-29
prompt_class: prompt
upstream_changes: accepted
author: upstream
validated: false
---
# Batch Submission, Webhooks, and Asynchronous Workflows
Webhook secret management, batch submit/poll/retrieve, the non-blocking fire-and-check
pattern, webhook payloads and signature verification, and webhook best practices.
### Webhook secret management
For webhook signature verification, manage secrets through your user account:
```python
import rowan
# Get your current webhook secret (returns None if none exists)
secret = rowan.get_webhook_secret()
if secret is None:
secret = rowan.create_webhook_secret()
# These functions return the secret as a plain string.
# Rotate your secret (invalidates old, creates new)
# Use this periodically for security.
secret = rowan.rotate_webhook_secret()
# Verify incoming webhook signatures.
is_valid = rowan.verify_webhook_secret(
raw_body=b"...", # Raw request body (bytes)
signature_header="sha256=...", # Value from X-Rowan-Signature
secret=secret,
)
```
## Batch submission and retrieval
For libraries or analogue series, submit in a loop using the specific workflow function. The generic `rowan.batch_submit_workflow()` and `rowan.submit_workflow()` functions currently return 422 errors from the API — use the named functions (`submit_descriptors_workflow`, `submit_pka_workflow`, etc.) instead.
### Submit a batch
```python
smileses = ["CCO", "CC(=O)O", "c1ccccc1O"]
names = ["ethanol", "acetic acid", "phenol"]
workflows = [
rowan.submit_descriptors_workflow(rowan.Molecule.from_smiles(smi), name=name)
for smi, name in zip(smileses, names)
]
print(f"Submitted {len(workflows)} workflows")
```
### Poll batch status
```python
statuses = rowan.batch_poll_status([wf.uuid for wf in workflows])
# Returns aggregate counts — not per-UUID:
# {'queued': 0, 'running': 1, 'complete': 2, 'failed': 0, 'total': 3, ...}
if statuses["complete"] == statuses["total"]:
print("All workflows done")
elif statuses["failed"] > 0:
print(f"{statuses['failed']} workflows failed")
```
### Retrieve and collect results
```python
results = []
for wf in workflows:
try:
result = wf.result()
results.append(result.data)
except rowan.WorkflowError as e:
print(f"Workflow {wf.uuid} failed: {e}")
# Optionally aggregate into DataFrame
import pandas as pd
df = pd.DataFrame(results)
```
### Non-blocking / fire-and-check pattern
For long-running workflows where you don't want to hold a process open, submit workflows, save their UUIDs, and check back later in a separate process.
**Session 1 — submit and save UUIDs:**
```python
import rowan, json
rowan.api_key = "..."
smileses = ["CCO", "CC(=O)O", "c1ccccc1O"]
workflows = [
rowan.submit_descriptors_workflow(
rowan.Molecule.from_smiles(smi), name=f"compound_{i}"
)
for i, smi in enumerate(smileses)
]
# Save UUIDs to disk (or a database)
uuids = [wf.uuid for wf in workflows]
with open("workflow_uuids.json", "w") as f:
json.dump(uuids, f)
print("Submitted. Check back later.")
```
**Session 2 — check status and collect results when ready:**
```python
import rowan, json
rowan.api_key = "..."
with open("workflow_uuids.json") as f:
uuids = json.load(f)
results = []
for uuid in uuids:
wf = rowan.retrieve_workflow(uuid)
if wf.done():
result = wf.result(wait=False)
results.append({"uuid": uuid, "data": result.data})
else:
print(f"{uuid}: still running ({wf.get_status()})")
print(f"Collected {len(results)} completed results")
```
## Webhooks and asynchronous workflows
For long-running campaigns or when you don't want to keep a process alive, use webhooks to notify your backend when workflows complete.
### Setting up webhooks
Every workflow submission function accepts a `webhook_url` parameter:
```python
wf = rowan.submit_docking_workflow(
protein=protein,
pocket=pocket,
initial_molecule=rowan.Molecule.from_smiles("CCO"),
webhook_url="https://myserver.com/rowan_callback",
name="docking with webhook",
)
print(f"Workflow submitted. Result will be POSTed to webhook when complete.")
```
Webhook URLs can be passed to any specific workflow function (`submit_docking_workflow()`, `submit_pka_workflow()`, `submit_descriptors_workflow()`, etc.).
### Webhook authentication with secrets
Rowan supports webhook signature verification to ensure requests are authentic. You'll need to:
1. **Create or retrieve a webhook secret:**
```python
import rowan
# Create a new webhook secret
secret = rowan.create_webhook_secret() # returns a string
# Store it securely; do not log it.
# Or retrieve an existing secret
secret = rowan.get_webhook_secret()
# Rotate your secret (invalidates old one, creates new)
new_secret = rowan.rotate_webhook_secret()
```
2. **Verify incoming webhook requests:**
```python
import rowan
import hmac
import json
def verify_webhook(request_body: bytes, signature: str, secret: str) -> bool:
"""Verify the HMAC-SHA256 signature of a webhook request."""
return rowan.verify_webhook_secret(request_body, signature, secret)
```
### Webhook payload and signature
When a workflow completes, Rowan POSTs a JSON payload to your webhook URL with the header:
```text
X-Rowan-Signature: <HMAC-SHA256 signature>
```
The request body contains the complete workflow result:
```json
{
"workflow_uuid": "wf_12345abc",
"workflow_type": "docking",
"workflow_name": "lead docking",
"status": "COMPLETED_OK",
"created_at": "2025-04-01T12:00:00Z",
"completed_at": "2025-04-01T12:15:30Z",
"data": {
"scores": [-8.2, -8.0, -7.9],
"best_pose": {...},
"metadata": {...}
}
}
```
### Example webhook handler with signature verification (FastAPI)
```python
from fastapi import FastAPI, Request, HTTPException
import rowan
import json
app = FastAPI()
webhook_secret = rowan.get_webhook_secret() or rowan.create_webhook_secret()
@app.post("/rowan_callback")
async def handle_rowan_webhook(request: Request):
# Get request body and signature
body = await request.body()
signature = request.headers.get("X-Rowan-Signature")
if not signature:
raise HTTPException(status_code=400, detail="Missing X-Rowan-Signature header")
# Verify signature
if not rowan.verify_webhook_secret(body, signature, webhook_secret):
raise HTTPException(status_code=401, detail="Invalid webhook signature")
# Parse and process
payload = json.loads(body)
wf_uuid = payload["workflow_uuid"]
status = payload["status"]
if status == "COMPLETED_OK":
print(f"Workflow {wf_uuid} succeeded!")
result_data = payload["data"]
# Process result, update database, trigger next workflow, etc.
elif status == "FAILED":
print(f"Workflow {wf_uuid} failed!")
# Handle failure
# Respond quickly to prevent retries
return {"status": "received"}
```
### Webhook best practices
- **Always verify signatures** using `rowan.verify_webhook_secret()` to ensure requests are from Rowan
- **Respond quickly** (< 5 seconds); offload heavy processing to async tasks or background jobs
- **Implement idempotency**: workflows may retry; handle duplicate payloads gracefully using `workflow_uuid`
- **Log all events** for debugging and audit trails
- **Use for long campaigns**: webhooks shine with 50+ workflows; for small jobs, polling with `result()` is simpler
- **Rotate secrets regularly** using `rowan.rotate_webhook_secret()` for security
- **Return 2xx status** to confirm receipt; Rowan may retry on 5xx errors
@@ -0,0 +1,132 @@
---
title: "End-to-End Example: Lead Optimization Campaign"
task: ""
lineage_type: import
upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/72d742e1/skills/rowan/references/end_to_end_example.md
upstream_sha: 72d742e1
imported_at: 2026-08-29
prompt_class: prompt
upstream_changes: accepted
author: upstream
validated: false
---
# End-to-End Example: Lead Optimization Campaign
A complete campaign: project and folder setup, tautomer selection, pKa and property
prediction across an analogue series, result collection and summary, and a docking
follow-up on the selected compound.
## End-to-end example: Lead optimization campaign
This example demonstrates a realistic workflow for optimizing a hit compound:
```python
import rowan
import pandas as pd
# 1. Create a project and folder for organization
project = rowan.create_project(name="CDK2 Hit Optimization")
rowan.set_project("CDK2 Hit Optimization")
folder = rowan.create_folder(name="round_1_tautomers_and_pka")
# 2. Load hit compound and analogues
hit = "CCNc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1" # Known hit
analogues = [
"CCNc1ncc(c(Nc2ccccc2)n1)-c1cccnc1", # Remove F
"CCNc1ncc(c(Nc2ccc(Cl)cc2)n1)-c1cccnc1", # Cl instead of F
"CCC(C)Nc1ncc(c(Nc2ccc(F)cc2)n1)-c1cccnc1", # Propyl instead of ethyl
]
# 3. Determine best tautomers (just in case)
print("Searching tautomeric forms...")
taut_workflows = [
rowan.submit_tautomer_search_workflow(
rowan.Molecule.from_smiles(smi), name=f"analog_{i}", folder=folder,
)
for i, smi in enumerate(analogues)
]
best_tautomers = []
for wf in taut_workflows:
result = wf.result()
best_tautomers.append(result.best_tautomer)
# 4. Predict pKa and basic properties for all analogues
print("Predicting pKa and properties...")
pka_workflows = [
rowan.submit_pka_workflow(
smi, method="chemprop_nevolianis2025", name=f"compound_{i}", folder=folder,
)
for i, smi in enumerate(best_tautomers)
]
descriptor_workflows = [
rowan.submit_descriptors_workflow(
rowan.Molecule.from_smiles(smi), name=f"compound_{i}", folder=folder
)
for i, smi in enumerate(best_tautomers)
]
# 5. Collect results
pka_results = []
for wf in pka_workflows:
try:
result = wf.result()
pka_results.append({
"compound": wf.name,
"pka": result.strongest_acid, # pKa of the strongest acid site
"uuid": wf.uuid,
})
except rowan.WorkflowError as e:
print(f"pKa prediction failed for {wf.name}: {e}")
descriptor_results = []
for wf in descriptor_workflows:
try:
result = wf.result()
desc = result.descriptors
descriptor_results.append({
"compound": wf.name,
"exact_mass": desc.get("MW"),
"topological_psa": desc.get("TopoPSA"),
"logp": desc.get("SLogP"),
"hba": desc.get("nHBAcc"),
"hbd": desc.get("nHBDon"),
"uuid": wf.uuid,
})
except rowan.WorkflowError as e:
print(f"Descriptor calculation failed for {wf.name}: {e}")
# 6. Merge and summarize
df_pka = pd.DataFrame(pka_results)
df_desc = pd.DataFrame(descriptor_results)
df = df_pka.merge(df_desc, on="compound", how="outer")
print("\n=== Preliminary SAR ===")
print(df.to_string())
# 7. Select promising compound for docking
# compound names are "compound_0", "compound_1", etc. — extract the index
top_idx = int(df.loc[df["pka"].idxmin(), "compound"].split("_")[1])
top_smiles = best_tautomers[top_idx]
print(f"\nProceeding with docking: {top_smiles}")
# 8. Docking campaign
protein = rowan.create_protein_from_pdb_id(code="1CKP", name="CDK2_1CKP")
pocket = [[10.5, 24.2, 31.8], [18.0, 18.0, 18.0]]
docking_wf = rowan.submit_docking_workflow(
protein=protein,
pocket=pocket,
initial_molecule=rowan.Molecule.from_smiles(top_smiles),
do_pose_refinement=True,
name=f"docking_{top_idx}",
)
dock_result = docking_wf.result()
print(f"\nDocking score: {dock_result.scores[0]:.2f} kcal/mol")
print(f"Best pose saved to: best_pose.pdb")
dock_result.best_pose.write("best_pose.pdb")
```
@@ -0,0 +1,119 @@
---
title: "Error Handling and Troubleshooting"
task: ""
lineage_type: import
upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/72d742e1/skills/rowan/references/troubleshooting.md
upstream_sha: 72d742e1
imported_at: 2026-08-29
prompt_class: prompt
upstream_changes: accepted
author: upstream
validated: false
---
# Error Handling and Troubleshooting
Common errors — invalid SMILES, missing API keys, HTTP/API failures, failed
workflows, and polling — with verified handling for `rowan-python` 3.1.13.
## Actual exception classes
`rowan.ValidationError`, `rowan.AuthenticationError`, and
`rowan.InsufficientCreditsError` do **not** exist in SDK 3.1.13. Referencing one
in an `except` clause raises `AttributeError` while handling the original
failure.
| Failure | Exception |
|---|---|
| Bad SMILES or wrong input type for a workflow | `ValueError` |
| Authentication, credit, or other HTTP/API failure | `httpx.HTTPStatusError` |
| Submitted workflow fails server-side | `rowan.WorkflowError` |
## Validate molecules before submission
```python
from rdkit import Chem
smiles = "CCCC(CC"
mol = Chem.MolFromSmiles(smiles)
if mol is None:
raise ValueError(f"Invalid SMILES: {smiles}")
```
Input types vary by workflow. For example, descriptors require a molecule
object, while pKa accepts a SMILES string:
```python
import rowan
try:
rowan.submit_descriptors_workflow("CCO")
except ValueError as exc:
print(f"Input problem: {exc}")
wf = rowan.submit_descriptors_workflow(rowan.Molecule.from_smiles("CCO"))
```
## Authentication and API errors
```python
import httpx
import rowan
try:
user = rowan.whoami()
except httpx.HTTPStatusError as exc:
if exc.response.status_code == 401:
print("Bad or missing API key — check ROWAN_API_KEY")
else:
# Includes credit limits and other API failures; inspect the response.
print(exc.response.status_code, exc.response.text)
raise
```
The SDK treats an environment variable set to an **empty string** as present.
That produces `401 Could not validate credentials` rather than a clear missing
key error. Check that `ROWAN_API_KEY` is non-empty without printing the key:
```python
import os
api_key = os.environ.get("ROWAN_API_KEY")
if not api_key:
raise RuntimeError("ROWAN_API_KEY is missing or empty")
```
Use `max_credits=N` on submission calls to bound spend.
## Server-side workflow failures
```python
try:
result = wf.result()
except rowan.WorkflowError as exc:
print(f"Workflow failed: {exc}")
print(f"Status: {wf.get_status()}")
```
## Polling and non-blocking checks
```python
# Block and poll every five seconds.
result = wf.result(wait=True, poll_interval=5)
# Or check without blocking.
if not wf.done():
print(f"Still running: {wf.get_status()}")
else:
result = wf.result(wait=False)
```
`WorkflowResult.complete` is a boolean, not a percent-done value. For coarse
status, use `wf.get_status()` and `wf.fetch_latest()`.
## Debugging tips
- Inspect `result.data` when a convenience property is unavailable.
- Save workflow UUIDs and reconnect with `rowan.retrieve_workflow(uuid)`.
- Use `dir(result)` to discover properties for that result class; they differ.
- Validate SMILES locally with RDKit before any paid submission.
@@ -2,9 +2,9 @@
title: "Stable Baselines3 Callback System" title: "Stable Baselines3 Callback System"
task: "" task: ""
lineage_type: import lineage_type: import
upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/9c9bd2e9/skills/stable-baselines3/references/callbacks.md upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/72d742e1/skills/stable-baselines3/references/callbacks.md
upstream_sha: 9c9bd2e9 upstream_sha: 72d742e1
imported_at: 2026-06-27 imported_at: 2026-08-29
prompt_class: prompt prompt_class: prompt
upstream_changes: accepted upstream_changes: accepted
author: upstream author: upstream
@@ -580,5 +580,5 @@ class DebugCallback(BaseCallback):
## Additional Resources ## Additional Resources
- Official SB3 Callbacks Guide: https://stable-baselines3.readthedocs.io/en/master/guide/callbacks.html - Official SB3 Callbacks Guide: https://stable-baselines3.readthedocs.io/en/master/guide/callbacks.html
- Callback API Reference: https://stable-baselines3.readthedocs.io/en/master/common/callbacks.html - Callback API Reference: https://stable-baselines3.readthedocs.io/en/master/guide/callbacks.html#module-stable_baselines3.common.callbacks
- TensorBoard Documentation: https://www.tensorflow.org/tensorboard - TensorBoard Documentation: https://www.tensorflow.org/tensorboard
@@ -2,9 +2,9 @@
title: "Vectorized Environments in Stable Baselines3" title: "Vectorized Environments in Stable Baselines3"
task: "" task: ""
lineage_type: import lineage_type: import
upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/9c9bd2e9/skills/stable-baselines3/references/vectorized_envs.md upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/72d742e1/skills/stable-baselines3/references/vectorized_envs.md
upstream_sha: 9c9bd2e9 upstream_sha: 72d742e1
imported_at: 2026-06-27 imported_at: 2026-08-29
prompt_class: prompt prompt_class: prompt
upstream_changes: accepted upstream_changes: accepted
author: upstream author: upstream
@@ -589,5 +589,5 @@ model = PPO.load("model", env=eval_env)
## Additional Resources ## Additional Resources
- Official SB3 VecEnv Guide: https://stable-baselines3.readthedocs.io/en/master/guide/vec_envs.html - Official SB3 VecEnv Guide: https://stable-baselines3.readthedocs.io/en/master/guide/vec_envs.html
- VecEnv API Reference: https://stable-baselines3.readthedocs.io/en/master/common/vec_env.html - VecEnv API Reference: https://stable-baselines3.readthedocs.io/en/master/guide/vec_envs.html#module-stable_baselines3.common.vec_env
- Multiprocessing Best Practices: https://docs.python.org/3/library/multiprocessing.html - Multiprocessing Best Practices: https://docs.python.org/3/library/multiprocessing.html