3.2 KiB
3.2 KiB
title, task, lineage_type, upstream_source, upstream_sha, imported_at, prompt_class, upstream_changes, author, validated
| title | task | lineage_type | upstream_source | upstream_sha | imported_at | prompt_class | upstream_changes | author | validated |
|---|---|---|---|---|---|---|---|---|---|
| RCSB Protein Data Bank (PDB) API Reference | import | https://github.com/K-Dense-AI/scientific-agent-skills/blob/9c9bd2e9/skills/database-lookup/references/pdb.md | 9c9bd2e9 | 2026-06-26 | prompt | accepted | upstream | false |
RCSB Protein Data Bank (PDB) API Reference
Base URLs
- Data API:
https://data.rcsb.org/rest/v1 - Search API:
https://search.rcsb.org/rcsbsearch/v2/query - GraphQL:
https://data.rcsb.org/graphql - Files:
https://files.rcsb.org
Authentication
None required. Fully public API.
Rate Limits
No published hard limits; be courteous (a few requests/second). Bulk downloads available via FTP.
Key Endpoints
1. Entry Lookup (Data API)
GET https://data.rcsb.org/rest/v1/core/entry/{entry_id}
Example:
GET https://data.rcsb.org/rest/v1/core/entry/4HHB
Returns JSON with resolution, method, deposition date, title, authors, etc.
2. Polymer Entity (chain-level info)
GET https://data.rcsb.org/rest/v1/core/polymer_entity/{entry_id}/{entity_id}
Example:
GET https://data.rcsb.org/rest/v1/core/polymer_entity/4HHB/1
3. Assembly Info
GET https://data.rcsb.org/rest/v1/core/assembly/{entry_id}/{assembly_id}
4. Full-Text and Attribute Search (Search API)
POST https://search.rcsb.org/rcsbsearch/v2/query
Content-Type: application/json
Example — search by UniProt accession:
{
"query": {
"type": "terminal",
"service": "text",
"parameters": {
"attribute": "rcsb_polymer_entity_container_identifiers.reference_sequence_identifiers.database_accession",
"operator": "exact_match",
"value": "P69905"
}
},
"return_type": "entry"
}
5. Sequence Search (Search API)
{
"query": {
"type": "terminal",
"service": "sequence",
"parameters": {
"evalue_cutoff": 0.1,
"identity_cutoff": 0.9,
"sequence_type": "protein",
"value": "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH"
}
},
"return_type": "polymer_entity"
}
6. Structure Similarity Search
{
"query": {
"type": "terminal",
"service": "structure",
"parameters": {
"value": {"entry_id": "4HHB", "assembly_id": "1"},
"operator": "strict_shape_match"
}
},
"return_type": "assembly"
}
7. Download Structure Files
GET https://files.rcsb.org/download/{entry_id}.cif
GET https://files.rcsb.org/download/{entry_id}.pdb
8. GraphQL Query
POST https://data.rcsb.org/graphql
Body example:
{
"query": "{ entry(entry_id: \"4HHB\") { rcsb_entry_info { resolution_combined } struct { title } } }"
}
Response Format
All REST/Search endpoints return JSON. File downloads return PDB/mmCIF text.
Useful return_type Values for Search
entry— PDB IDspolymer_entity— entity-level results (e.g., 4HHB_1)assembly— biological assembly results
Notes
- Search API uses POST with a JSON query DSL. Combine queries with
"type": "group"and"logical_operator": "and"/"or". - Pagination via
"request_options": {"paginate": {"start": 0, "rows": 25}}.