Files
drug-discovery-prompts/upstream/K-Dense-AI-scientific-agent-skills/skills/tamarind/references/examples.md

146 lines
7.0 KiB
Markdown
Raw Permalink Blame History

This file contains ambiguous Unicode characters
This file contains Unicode characters that might be confused with other characters. If you think that this is intentional, you can safely ignore this warning. Use the Escape button to reveal them.
---
title: "Tamarind Bio — validated examples & output shapes"
task: ""
lineage_type: import
upstream_source: https://github.com/K-Dense-AI/scientific-agent-skills/blob/0807ddbc/skills/tamarind/references/examples.md
upstream_sha: 0807ddbc
imported_at: 2026-06-30
prompt_class: prompt
upstream_changes: accepted
author: upstream
validated: false
---
# Tamarind Bio — validated examples & output shapes
**The freshest example for any tool is the `exampleJob` field MCP `getJobSchema(<tool>)`
now returns** — an `{jobName, type, settings}` built from each param's example/default
(with an `exampleJobNote`; org-gated params you can't use are omitted, file params get
placeholder filenames). It's the best starting point, but **run `validateJob` on it
before submitting** — it's assembled from per-param examples, not a guaranteed-valid
payload, so a given tool's `exampleJob` can need a tweak. The payloads below are a
`validateJob`-confirmed fallback for REST callers or when you want a worked example.
Tool schemas evolve — if one stops validating, re-fetch with `getJobSchema(<tool>)` /
`GET /tools`. Sequences here are illustrative; swap your own.
**File params (`proteinFile`, `pdbFile`, `ligandFile`, …) need a real file value** —
either the **bare filename** of an uploaded file (`target.pdb` — NOT email-prefixed),
a prior-job output **path** (`JobName/out/x.pdb`), or
**inline PDB/SDF-format text** (multi-line `ATOM`/`HETATM` records). The
`<...>` placeholders below are NOT valid as written — replace them. **Do not put an
amino-acid sequence in a file param** — `validateJob` rejects it with
`File ... must be of types: ["pdb"]`. (A sequence goes in `sequence`, a structure
goes in a file param.)
`BASE = "https://app.tamarind.bio/api"`, `HEADERS = {"x-api-key": <key>}`.
## Self-check (run this first to confirm the skill works for you)
Read-only + dry-run, no submission, no cost. Confirms the discover → schema →
validate loop end-to-end:
```python
import os, requests
BASE, HEADERS = "https://app.tamarind.bio/api", {"x-api-key": os.environ["TAMARIND_API_KEY"]}
# 1. discovery reachable?
tools = requests.get(f"{BASE}/tools", headers=HEADERS).json()
assert isinstance(tools, list) and any(t["name"] == "alphafold" for t in tools), "tools endpoint"
# 2. validate a known-good payload (MCP validateJob; or skip if REST-only)
# expect {"valid": true, ...}
```
With the MCP server: `validateJob(jobName="selfcheck", type="alphafold",
settings={"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIE"})` → `valid: true`.
## Validated input payloads
### AlphaFold — monomer
```json
{ "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKR",
"numModels": "1", "numRecycles": 3 }
```
Only `sequence` is required; everything else has a default. `numModels` is a string
dropdown (`"1"`–`"5"`).
### AlphaFold — multimer (colon-separated chains)
```json
{ "sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIE:DIQMTQSPSSLSASVGDRVTITCRASQSISSYLN" }
```
Join chains with `:`. No separate "multimer" flag — chain count drives it.
### Boltz-2 — sequence mode
```json
{ "inputFormat": "sequence",
"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALP" }
```
`inputFormat` is **required** (`"sequence"` / `"list"` / `"molecules"` / `"yaml"`).
Omitting it fails — see "What fails" below.
### DiffDock — protein + SMILES ligand
```json
{ "ligandFormat": "SMILES",
"ligandSmiles": "CC(=O)Oc1ccccc1C(=O)O",
"proteinFile": "<uploaded-path-or-inline-PDB-text>" }
```
`ligandFormat` chooses the conditional field: `"SMILES"` → `ligandSmiles`;
`"sdf/mol2 file"` → `ligandFile`. `proteinFile` is a file param — pass an uploaded
file's bare filename (`target.pdb`, not email-prefixed), a prior-job path
(`JobName/...`), or inline PDB text (see file-input rules in `api_reference.md`).
### Autodock Vina — protein + SMILES ligand (classical docking into a pocket)
```json
{ "receptorFile": "receptor.pdb",
"ligandFormat": "smiles",
"ligandSmiles": "CC(=O)Oc1ccccc1C(=O)O",
"boxX": 15.19, "boxY": 53.903, "boxZ": 16.917,
"width": 20, "height": 20, "depth": 20 }
```
Unlike DiffDock, Autodock Vina docks into a **fixed pocket**, so it requires a bounding
box (`boxX/Y/Z` center + `width/height/depth`, all required) and the receptor in
`receptorFile` (not `proteinFile`). Its `ligandFormat` enum is **lowercase**
(`"smiles"` / `"sdf"`) — different from DiffDock's `"SMILES"` / `"sdf/mol2 file"`, so
don't copy DiffDock's value across. `exhaustiveness` (default 8) is optional. `validateJob`-confirmed.
### ProteinMPNN — design residues on a backbone
```json
{ "pdbFile": "<uploaded-path-or-inline-PDB-text>",
"designedResidues": { "A": "1 2 3 4 5" },
"numSequences": 4, "modelType": "proteinmpnn" }
```
Requires `pdbFile` + `designedResidues` (per-chain, space-separated resnums).
`modelType` ∈ `proteinmpnn`/`ligandmpnn`/`solublempnn`/`hypermpnn`/`abmpnn`.
Note `designedChains` is `exclude:["api"]` — don't send it over the API.
### Batch (same tool, many jobs)
```json
{ "batchName": "screen-1", "type": "alphafold",
"jobNames": ["s1", "s2"],
"settings": [ { "sequence": "MKT..." }, { "sequence": "AVF..." } ] }
```
## What fails (and the exact error) — confirmed live
- **Boltz without `inputFormat`** → `valid:false`, `Missing required boltz field "inputFormat"`. Always check required fields with `getJobSchema` first; `sequence` alone is not enough for boltz/chai.
- **Building a submit from `validateJob`'s `normalized` blob** — `normalized` is informational (defaults filled in, sometimes platform-managed fields). Submit the clean `settings` you validated, not the normalized echo.
- **File param given a bare string that isn't a real path** → treated as INLINE file content (uploaded as `<email>/<jobname>-<param>.<ext>`), not a reference. To point at an existing uploaded file use its **bare filename** (`target.pdb` — do NOT email-prefix it; `{email}/{filename}` is the S3 key and 400s as not-uploaded), or `JobName/...` for a prior job's output. Referencing a path that doesn't exist → `File ... has not been uploaded`.
## Output shapes (describe, don't expect exact values)
Outputs are non-deterministic (seed/model/MSA) — reason about the *shape*, not
golden numbers.
- **Job row `Score`** (JSON string on completed jobs): tool-family dependent.
- Folding (alphafold/boltz/chai/esmfold): `plddt`, `ptm`, and for complexes
`iptm` plus interface metrics (`ipSAE_*`, `pDockQ_*`). Higher pLDDT/pTM = more
confident; iptm/ipSAE gauge interface quality.
- Other families carry their own metrics — read the keys, don't assume.
- **Results zip** (`POST /result` → presigned URL → GET): per-tool, typically the
structure files (`rank_*.pdb` / `*.cif`), a scores CSV, and logs. Use
`listJobFiles(jobName)` (MCP) to enumerate exact filenames before downloading.
- **`WeightedHours`** on the row is the billing unit (see `usage-statistics`).
To learn a specific tool's exact outputs, run one small job and `listJobFiles` it —
don't hardcode filenames, which vary by tool and version.